Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS: 159002-68-3
Ref. 3D-PGL-3826-PI
1mg | 1,007.00 € | ||
5mg | 3,783.00 € |
Product Information
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form.
One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Chemical properties
Technical inquiry about: 3D-PGL-3826-PI Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.