
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:
Ref. 3D-PGL-3826-PI
1mg
940.00€
5mg
3,447.00€

Product Information
Name:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
Brand:Biosynth
Description:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form.One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,449.93 g/mol
Formula:C192H295N61O60S
Purity:Min. 95%
Technical inquiry about: Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.