Product Information
Name:GRF (Human)
Synonyms:
- Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-lle-Met-Ser-Arg-Gln-Gln-Gly-Glu- Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 Growth Hormone Releasing Factor (Human)
- GHRH
Brand:Biosynth
Description:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion. See also GRF (1-29); sermorelin, a shorter fragment. Sequence alignments: porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:5,039.7 g/mol
Formula:C215H358N72O66S
Purity:Min. 95%
Technical inquiry about: GRF (Human)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.