H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Ref. 3D-PP46273
Undefined size | To inquire |
Product Information
- NH2-Glu-Ala-Glu-Glu-Phe-Phe-Glu-Leu-Ile-Ser-Lys-Ala-Gln-Ser-Asn-Arg-Ala-Asp-Asp-Gln-Arg-Gly-Leu-Leu-Arg-Lys-Glu-Asp-Leu-Val-Leu-Pro- Glu-Phe-Leu-Arg-amide
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 include the following: Purification and in vitro functional analyses of RGS12 and RGS14 GoLoco motif peptides RJ Kimple , FS Willard , DP Siderovski - Methods in enzymology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687904900262
Chemical properties
Technical inquiry about: 3D-PP46273 H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.