H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Ref. 3D-PP47267
Undefined size | To inquire |
Product Information
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH include the following: EGFR S1166 phosphorylation induced by a combination of EGF and gefitinib has a potentially negative impact on lung cancer cell growth BF Assiddiq, KY Tan, W Toy, SP Chan - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3002029
Chemical properties
Technical inquiry about: 3D-PP47267 H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.