CymitQuimica logo

Neuropeptide Y, human, rat

CAS:

Ref. 3D-PP50242

ne
To inquire
Neuropeptide Y, human, rat
Biosynth

Product Information

Name:Neuropeptide Y, human, rat
Synonyms:
  • Neuropeptide Y
  • human
  • rat H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-N
Brand:Biosynth
Description:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:4,271.74 g/mol
Formula:C189H285N55O57S1

Technical inquiry about: Neuropeptide Y, human, rat

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.