Product Information
- H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide
- 24:PN: WO2005059515 SEQID: 16 claimed protein
- Nep1-40
- Nogo receptor antagonistNEP1-40 (synthetic)
- Protein NEP1-40 (synthetic)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50250 NEP(1-40)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.