Product Information
Name:NEP(1-40)
Synonyms:
- H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide
Brand:Biosynth
Description:Nogo-66 (1-40) is a peptide that is used as a research tool in cell biology, pharmacology and neuroscience. It is an inhibitor of the receptor for nerve growth factor (NGF), which has been shown to inhibit the activity of Nogo-A, a protein that prevents axonal growth. Nogo-66 (1-40) binds to the Nogo receptor on cells and blocks its ability to bind with NGF, preventing it from inhibiting axonal growth. This antibody can be used in research on ion channels, protein interactions and receptors.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,583.08 g/mol
Formula:C206H324N56O65
Technical inquiry about: NEP(1-40)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.