Product Information
Name:GIP (3 - 42), human
Synonyms:
- GIP (3-42)
- human H-EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNI
Brand:Biosynth
Description:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,749.38 g/mol
Formula:C214H324N58O63S
Technical inquiry about: GIP (3 - 42), human
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
