
Enterocin 7B
Ref. 3D-PP50444
ne
To inquire

Product Information
Name:Enterocin 7B
Synonyms:
- H-MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH-OH NH2-Met-Gly-Ala-Ile-Ala-Lys-Leu-Val-Ala-Lys-Phe-Gly-Trp-Pro-Phe-Ile-Lys-Lys-Phe-Ty r-Lys-Gln-Ile-Met-Gln-Phe-Ile-Gly-Gln-Gly-Trp-Thr- Ile-Asp-Gln-Ile-Glu-Lys-Trp-Leu-Lys-Arg-His-OH
Brand:Biosynth
Description:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: Enterocin 7B
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.