SNRP70
Ref. 3D-PP50461
Undefined size | To inquire |
Product Information
- H-PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS-OH NH2-Pro-His-Asn-Asp-Pro-Asn-Ala-Gln-Gly-Asp-Ala-Phe-Lys-Thr-Leu-Phe-Val-Ala -Arg-Val-Asn-Tyr-Asp-Thr-Thr-Glu-Ser-Lys-Leu-Arg-Arg-Glu- Phe-Glu-Val-Tyr-Gly-Pro-Ile-Lys-Arg-Ile-His-Met-Val-Tyr-Ser-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50461 SNRP70
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.