Neuregulin 4 (Nrg4) / pro-Neuregulin 4 (1-61) (Human)
Ref. 3D-PP50511
Undefined size | To inquire |
Product Information
- H-MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNL-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50511 Neuregulin 4 (Nrg4) / pro-Neuregulin 4 (1-61) (Human)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.