CymitQuimica logo

TLQP-62, Rat

Ref. 3D-PP50611

ne
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

TLQP-62, Rat
Biosynth

Product Information

Name:TLQP-62, Rat
Synonyms:
  • H-TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP-OH
Brand:Biosynth
Description:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:7,401.13 g/mol

Inquiry about discontinued product: TLQP-62, Rat

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.