![discount label](https://static.cymitquimica.com/public/img/discount.png)
Product Information
- β- Amyloid (1-38) H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
- Amyloid .beta.-Protein (1-38)
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50622 β-Amyloid (1-38)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.