Mouse Beta-Defensin 3 peptide
Ref. 3D-PP51064
| 100µg | 533.00 € |
Product Information
- H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH
mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family.
Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair.
mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL). Antimicrobial activity has also been demonstrated against C.Albicans.
The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.
Chemical properties
Technical inquiry about: 3D-PP51064 Mouse Beta-Defensin 3 peptide
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
