Scrambled Cathelicidin antimicrobial peptide 18
Ref. 3D-PP51067
1mg
276.00€
Product Information
Name:Scrambled Cathelicidin antimicrobial peptide 18
Synonyms:
- H-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR-OH
Brand:Biosynth
Description:Scrambled LL-37 has the same peptide sequence as LL-37 but loses helixforming property.Scrambled LL-37 can be used as a negative control of LL-37 studies.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: Scrambled Cathelicidin antimicrobial peptide 18
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.