Scrambled Cathelicidin antimicrobial peptide 18
Ref. 3D-PP51067
1mg | 294.00 € |
Product Information
- H-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR-OH
Scrambled LL-37 has the same peptide sequence as LL-37 but loses helixforming property.
Scrambled LL-37 can be used as a negative control of LL-37 studies.
Chemical properties
Technical inquiry about: 3D-PP51067 Scrambled Cathelicidin antimicrobial peptide 18
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.