Product Information
- H-IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP-OH
- α-Cobratoxin
α7 nicotinic acetylcholine receptor (nAChR) antagonist
Chemical properties
Technical inquiry about: 3D-PP51159 alpha-cobratoxin
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.