Product Information
- H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH
- M.W. 5417.05 C217H341N71O74S9 (Disulfide bonds between Cys2 and Cys11/Cys7 and Cys32/ Cys8 and Cys37/Cys20 and Cys39)
Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.
Chemical properties
Technical inquiry about: 3D-PP51166 Echistatin α1 isoform
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.