Product Information
Name:Echistatin α1 isoform
Synonyms:
- H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH
Brand:Biosynth
Description:Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: Echistatin α1 isoform
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.