CymitQuimica logo

Echistatin α1 isoform

CAS:

Ref. 3D-PP51166

100µg
473.00€
Echistatin α1 isoform
Biosynth

Product Information

Name:Echistatin α1 isoform
Synonyms:
  • H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH
Brand:Biosynth
Description:Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Technical inquiry about: Echistatin α1 isoform

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.