
MT7 - Muscarinic Toxin 7
Ref. 3D-PP51183
100µg
495.00€

Product Information
Name:MT7 - Muscarinic Toxin 7
Synonyms:
- H-LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH
Brand:Biosynth
Description:Blocker of M1-subtype of muscarinic receptor
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: MT7 - Muscarinic Toxin 7
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.