Exendin-4 peptide derivative
Ref. TM-TP1161
1mg | 258.00 € | ||
5mg | 924.00 € | ||
10mg | 1,399.00 € |
Product Information
- FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.
Chemical properties
Technical inquiry about: TM-TP1161 Exendin-4 peptide derivative
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.