

Exendin-4 peptide derivative
Ref. TM-TP1161


Product Information
Name:Exendin-4 peptide derivative
Synonyms:
- FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Brand:Targetmol
Description:Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:3692.15
Purity:98%
Color/Form:Solid
Technical inquiry about: Exendin-4 peptide derivative
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.