Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
RFX2 antibody
The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.
Rabbit anti Whole Bovine serum antibody (IgG fraction)
Whole bovine serum antibody (IgG fraction) was raised in rabbit using bovine serum as the immunogen.Pureza:Min. 95%Goat anti Human IgG (H + L) (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Pureza:Min. 95%DYSF antibody
DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNEPureza:Min. 95%ACADL antibody
The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.
NOS2 antibody
The NOS2 antibody is a highly specialized autoantibody that targets the glycan structure of the EBNA1 protein. This polyclonal antibody is derived from plasmids and has been extensively studied for its genotoxic effects. It specifically recognizes and binds to the NOS2 protein, an important enzyme involved in nitric oxide production. The NOS2 antibody can be used in various life science applications, including research on interferon and interleukin-6 signaling pathways. Additionally, it is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their specific needs. Trust in the reliability and specificity of this antibody to enhance your experiments in the field of life sciences.
Chicken anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Pureza:Min. 95%CD19 antibody (Allophycocyanin)
CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Pureza:Min. 95%GPR4 antibody
The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.
