Anticorpos primários

Goat anti-cat IgG (H+L) was raised in goat using feline IgG whole molecule as the immunogen.

ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogen

The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.

USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal RPL17 antibody (FITC)

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.

Sheep polyclonal Tacrolimus 22 antibody

BIRC8 antibody was raised in Rabbit using Human BIRC8 as the immunogen

The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.

Mouse monoclonal ZIM2 antibody

Mouse monoclonal MICAL1 antibody

DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

Affinity purified Rabbit polyclonal MDH2 antibody

CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.

FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.