Anticorpos primários

The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.

The FGF1 antibody is a powerful globulin that acts as a family kinase inhibitor, specifically targeting endothelial growth. This antibody is widely used in the field of Life Sciences and is highly effective in inhibiting cdk4/6, a crucial enzyme involved in cell cycle regulation. Additionally, the FGF1 antibody has shown remarkable neutralizing properties against caspase-9, an enzyme responsible for initiating apoptosis. With its polyclonal nature, this antibody exhibits high specificity and affinity towards alpha-fetoprotein, making it an ideal tool for research involving adipose tissue. Furthermore, the FGF1 antibody has demonstrated antiviral activity and can effectively target molecules associated with viral infections. Its colloidal formulation ensures stability and ease of use. Researchers also utilize this antibody as an anti-VEGF agent due to its ability to counteract vascular endothelial growth factor.

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

Affinity purified Rabbit polyclonal NPEPPS antibody

CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.

The STAT3 antibody is a powerful tool used in life sciences research to study the function and activity of the transcription factor STAT3. This antibody specifically recognizes and binds to the phosphorylated form of STAT3, allowing researchers to investigate its role in various cellular processes. The chromatin immunoprecipitation assay can be performed using this antibody to analyze the DNA binding activity of STAT3 and identify its target genes. Additionally, the STAT3 antibody has been shown to inhibit the growth factor-induced transmembrane conductance in certain cell types. It has also been implicated in neuroprotective effects and plays a crucial role in the regulation of cytokine family signaling pathways, such as interleukin-6. With its high specificity and potency, this polyclonal antibody is an essential tool for scientists studying signal transduction pathways mediated by STAT3.

Rabbit polyclonal OCIAD1 antibody

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT

H2AFY2 antibody was raised in Rabbit using Human H2AFY2 as the immunogen

BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen

Rabbit polyclonal PARK2 antibody (Ser101)

Rabbit polyclonal PAK1/PAK2/PAK3 antibody

FBXO7 antibody was raised in Rabbit using Human FBXO7 as the immunogen

Affinity purified Rabbit polyclonal CYP11B1 antibody

ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

LASP1 antibody was raised in Rabbit using Human LASP1 as the immunogen

Rabbit polyclonal ZFYVE16 antibody