Anticorpos primários

Rabbit polyclonal ABL1/2 antibody

Rabbit polyclonal GLI3 antibody

TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.

Nurr1 antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Nurr1 protein as the immunogen.

Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

Mouse monoclonal ARHGAP25 antibody

The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.

DDI1 antibody was raised in Rabbit using Human DDI1 as the immunogen

ZNF44 antibody was raised in mouse using recombinant Human Zinc Finger Protein 44 (Znf44)

CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.

Rat monoclonal CD144 antibody (PE)

CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Goat anti-mouse IgG/IgM (H+L) (Alk Phos) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

ZNF335 antibody was raised in rabbit using the middle region of ZNF335 as the immunogen