Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75512 produtos de "Anticorpos primários"
Calpain 10 antibody
Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC
TXNRD1 antibody
The TXNRD1 antibody is a highly specialized product used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with a versatile tool for their experiments.
DGKA antibody
The DGKA antibody is a highly specific monoclonal antibody that is used in immunoassays and research applications. It is designed to target and bind to the DGKA protein, which plays a crucial role in various biological processes. This antibody can be used for the detection and quantification of DGKA in samples, making it an essential tool for researchers in the Life Sciences field.RSV antibody (FITC)
RSV antibody (FITC) was raised in mouse using nucleoprotein of RSV as the immunogen.CD180 antibody
The CD180 antibody is a monoclonal antibody that acts as a neutralizing agent against autoantibodies. It targets the growth factor CD180 and inhibits its activity, preventing the harmful effects of autoantibodies. This antibody has been shown to inhibit the activation of caspase-9 and GAPDH, two proteins involved in cell death processes. Additionally, it has been found to have cytotoxic effects on adipocytes, suggesting its potential use in obesity-related disorders. The CD180 antibody also shows promise in the field of life sciences, with applications in research related to hormones such as glucagon and dopamine.CD11b antibody
CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface protein involved in various immune responses. This antibody has been shown to neutralize the activity of CD11b and inhibit its function in immune cells. CD11b antibody has been used in research studies to investigate the role of CD11b in different biological processes, including hepcidin regulation, interleukin-6 signaling, and syncytia formation. It has also been shown to modulate intracellular signaling pathways such as the p38 MAPK pathway and protein kinases. This antibody is widely used in life sciences research for its ability to selectively bind and block CD11b activity, making it a valuable tool for studying immune responses and developing potential therapeutic interventions.
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa731-909) expressed in E. coli as the immunogen.HMBS antibody
HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA
