Anticorpos primários

FLCN antibody was raised in rabbit using the N terminal of FLCN as the immunogen

Complement C5 antibody was raised in mouse using human complement component C5 as the immunogen.

The VDAC1 antibody is a highly specific and activated antibody that targets the voltage-dependent anion channel 1 (VDAC1). It is commonly used in research and laboratory settings for various applications, including immunoassays, protein detection, and Western blotting. The hydroxy group of the VDAC1 antibody enables it to efficiently bind to its target, providing accurate and reliable results.

CHCHD6 antibody was raised in rabbit using the middle region of CHCHD6 as the immunogen

Affinity purified Rabbit polyclonal SMC1A antibody

FFAR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Rabbit polyclonal THBD antibody

UBE2L6 antibody was raised using the middle region of UBE2L6 corresponding to a region with amino acids QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG

Purified Polyclonal RPC antibody

The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.

Mouse monoclonal Hepatitis C Virus antibody (core)

Mouse monoclonal EPSP synthase antibody

The BARHL2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including the regulation of dopamine and nuclear receptor signaling pathways. This antibody has been extensively studied and proven to be effective in blocking the interaction between domperidone and metoclopramide with their respective receptors.

The TMED2 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the TMED2 protein, which is involved in the transport of cargo proteins between the endoplasmic reticulum and Golgi apparatus. This antibody has been extensively studied in Life Sciences research and has shown promising results in understanding cellular mechanisms.

Affinity purified Chicken polyclonal 200 kDa Neurofilament antibody