Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
Aminoacylase 1 antibody
The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.
IL7 antibody
IL7 antibody was raised in mouse using highly pure recombinant human IL-7 as the immunogen.ACTH antibody
Adrenocorticotropic Hormone antibody was raised in rabbit using synthetic ACTH as the immunogen.Pureza:Min. 95%SYN1 antibody
The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.
Horse RBC antibody
Horse RBC antibody was raised in rabbit using equine erythrocytes as the immunogen.Pureza:Min. 95%SPTAN1 antibody
SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Laminin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Pureza:Min. 95%CYP2A6 antibody
The CYP2A6 antibody is a highly specialized monoclonal antibody that is widely used in clinical research and diagnostics. It is specifically designed to detect the presence of CYP2A6, an important protein kinase involved in various cellular processes. This antibody has proven to be highly effective in immunohistochemistry studies, allowing for the precise localization and quantification of CYP2A6 expression in tissues and cells. Its high specificity ensures accurate detection, making it an invaluable tool for researchers working in the field of oncology, as well as other areas of life sciences. With its exceptional performance and reliability, the CYP2A6 antibody is a must-have for any laboratory or research facility conducting studies related to protein expression and function.
