Anticorpos primários

The Adenosine Deaminase antibody is a highly specialized biomolecule used in Life Sciences research. It is available as both a monoclonal and polyclonal antibody, making it versatile for various applications. This antibody specifically targets and binds to adenosine deaminase, an enzyme involved in the breakdown of adenosine.

The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.

PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV

The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.

ATP13A1 antibody was raised in Rabbit using Human ATP13A1 as the immunogen

The GALNS antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets and binds to a specific antigen, allowing for precise detection and analysis of various biological processes. In addition to its use as a diagnostic tool, the GALNS antibody has also been found to have therapeutic potential.

Mycoplasma pneumoniae antibody is a specialized protein that targets the circumsporozoite protein of the bacteria. This antibody has been shown to have anti-glial fibrillary acidic properties, acting as a growth factor and neurotrophic agent. It is a monoclonal antibody that specifically neutralizes Mycoplasma pneumoniae and has been extensively studied in the field of Life Sciences. The antibody has also been found to exhibit tyrosine phosphatase activity and has potential neuroprotective effects. With its unique properties, this Mycoplasma pneumoniae antibody offers promising applications in various research areas and can be a valuable tool for scientists studying antibodies and their functions.

The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.

Monkey RBC antibody (Texas Red) was raised in rabbit using monkey erythrocytes as the immunogen.

Mouse monoclonal Cardiotin antibody

The MUC2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets the MUC2 protein, which plays a crucial role in maintaining the integrity of the mucosal barrier in various tissues. This antibody can be used for research purposes to study the function and regulation of MUC2 in different biological processes.

YIPF4 antibody was raised in rabbit using the N terminal of YIPF4 as the immunogen

The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.

Rabbit Polyclonal GSK3 beta antibody (Tyr216)

KTN1 antibody was raised in Rabbit using Human KTN1 as the immunogen

GSR antibody was raised in Rabbit using Human GSR as the immunogen

Rabbit polyclonal GPR83 antibody

DOK2 antibody was raised in Rabbit using Human DOK2 as the immunogen

Affinity purified Rabbit polyclonal Aladin antibody

The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.