Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
CD33 antibody
CD33 antibody was raised in Mouse using a purified recombinant fragment of CD33(48-258) expressed in E. coli as the immunogen.ACTH antibody
The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.
CDCA5 antibody
CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST
PGP9.5 antibody
PGP9.5 antibody was raised in mouse using recombinant human PGP9.5 (1-223aa) purified from E. coli as the immunogen.Rabbit anti Goat IgG (H + L) (Alk Phos)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Pureza:Min. 95%EPHA2 antibody
The EPHA2 antibody is a highly specialized monoclonal antibody that targets the elastase protein, an enzyme involved in various physiological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of elastase. It is widely used in Life Sciences research for its ability to specifically bind to elastase and neutralize its function.
TAF1 antibody
The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.
Anti-HIV P24 monoclonal antibody
Please enquire for more information about Anti-HIV P24 monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
