Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
PAPPA antibody
PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
MAD2L1 antibody
MAD2L1 antibody was raised in rabbit using the middle region of MAD2L1 as the immunogen
Estrogen Receptor alpha antibody (Ser106)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)
NSUN3 antibody
NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP
FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
