Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.
CD55 antibody
The CD55 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, a key molecule involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the treatment of HER2-positive cancers.
Factor XII antibody
Factor XII antibody was raised in goat using human Factor XII purified from plasma as the immunogen.
BHMT antibody
The BHMT antibody is a monoclonal antibody that is reactive against amyloid plaque. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets β-catenin, which is an important protein involved in cellular signaling pathways. It has been shown to be activated in various diseases, including cancer. The BHMT antibody can also be used to detect and measure levels of glial fibrillary acidic protein (GFAP), which is a marker for astrocytes. Additionally, this antibody has been used in studies investigating the role of dopamine and other neurotransmitters in neurological disorders. It can be utilized as a tool for inhibiting protein kinase activity and studying its effects on cellular processes. The BHMT antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. It can be purchased in colloidal form for ease of use and accurate results.
RhoA antibody
The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.
PNMT antibody
The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.
NRIP1 antibody
NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)PRAME antibody
PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
Rat PMN antibody (FITC)
Rat PMN antibody (FITC) was raised in rabbit using rat PMNs as the immunogen.
FGFR2 antibody
The FGFR2 antibody is a specific monoclonal antibody that targets the fibroblast growth factor receptor 2 (FGFR2). It has been extensively studied in the field of life sciences and has shown promising results in various applications. This antibody is highly specific and binds to non-phosphorylated FGFR2, inhibiting its activity.SMYD3 antibody
The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.
