Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
PNPase antibody
The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.
RGS3 antibody
RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
Clostridium difficile toxin A antibody
Clostridium difficile toxin A antibody is a highly specialized antibody that specifically targets the cytotoxic molecule produced by Clostridium difficile bacteria. This antibody, available in both polyclonal and monoclonal forms, is used to neutralize the toxin and prevent its harmful effects on cells. By binding to the toxin, the antibody inhibits its ability to cause cell cytotoxicity.
