Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
HADHB antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through experiments using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
IARS antibody
IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
PCNP antibody
The PCNP antibody is a highly specialized and versatile product used in the field of Life Sciences. This antibody is derived from adeno-associated virus and has been pegylated for enhanced stability and efficacy. It specifically targets actin filaments, which play a crucial role in various cellular processes.
ACTH antibody
The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.
STUB1 antibody
STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF
Myc Tag antibody
The Myc Tag antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It is designed to specifically recognize and bind to the Myc epitope tag, a small peptide sequence derived from the c-myc gene. This antibody has been extensively validated for its high affinity and specificity in detecting proteins tagged with the Myc epitope.CKS2 antibody
The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.
RBP1 antibody
RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
