Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
FBXO24 antibody
FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG
WNT16 antibody
WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
IGJ antibody
The IGJ antibody is a monoclonal antibody that specifically targets insulins. It is cytotoxic and works by binding to insulin molecules, rendering them inactive. This colloidal antibody has neutralizing properties, meaning it can effectively counteract the effects of autoantibodies that may be present in the body. The IGJ antibody is designed to target specific amino acid residues on insulin, ensuring precise and effective binding. It has been extensively tested in Life Sciences research and has shown high affinity for insulin in human serum samples. With its histidine-rich structure, this monoclonal antibody offers a reliable tool for studying insulin-related processes and mechanisms.
RAB11FIP5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.
GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ
RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes epidermal growth factor (EGF)-like growth factor, which plays a crucial role in cell proliferation and survival. This antibody is designed to bind with high affinity to EGF-like growth factors, preventing their interaction with receptors on the surface of cells.
HIV1 tat antibody
HIV1 tat antibody was raised in mouse using HIV-1 tat epitope mapped to N-terminus of HIV -1 tat as the immunogen.
