Anticorpos primários

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>Purified Polyclonal GAD1/2 antibody</p>

<p>DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>IKK-gamma antibody was raised in rabbit using residues 2-13 [NRHLWKSQLCEM] of the IKK-gamma protein as the immunogen.</p>

<p>The Calnexin antibody is a growth factor that has various applications in the field of Life Sciences. It can be used in research studies involving trastuzumab, insulin, and anti-HER2 antibodies. This antibody specifically targets the thymidylate amino group in proteins and is commonly used for detecting and quantifying specific proteins of interest. The Calnexin antibody is a monoclonal antibody that recognizes the carbonyl group on proteins and can be utilized in various assays such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is also used to detect autoantibodies or Polyclonal Antibodies against specific proteins. With its wide range of applications, the Calnexin antibody is an essential tool for researchers in the Life Sciences field.</p>

<p>Mouse monoclonal HAG2 antibody</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ</p>

<p>Purified Rabbit polyclonal MADS91 antibody</p>

<p>Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF</p>

<p>Purified Polyclonal DNAJB11 antibody</p>

<p>The PKD1 antibody is a highly specific and potent antibody that is used in the field of Life Sciences. It is derived from human serum and belongs to the class of Polyclonal Antibodies. This antibody targets the PKD1 protein, which plays a crucial role in various cellular processes. It has been extensively studied and validated for its ability to detect and quantify PKD1 levels in biological samples.</p>

<p>HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE</p>

<p>The RAF1 antibody is a highly specific and activated monoclonal antibody that is used in various applications within the field of Life Sciences. This antibody specifically targets RAF1, a protein involved in the mitogen-activated protein kinase (MAPK) signaling pathway. It has been extensively tested and validated for its use in research studies.</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>Rabbit polyclonal LN28A antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK</p>