Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.793 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(736 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75326 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
POSTN antibody
<p>POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL</p>Pureza:Min. 95%ERCC1 antibody
<p>The ERCC1 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize the alpha-fetoprotein, which is a protein associated with certain types of cancer. The antibody works by binding to the alpha-fetoprotein, preventing its interaction with other proteins and inhibiting its function.</p>C17ORF57 antibody
<p>C17ORF57 antibody was raised using the N terminal Of C17Orf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL</p>TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Pureza:Min. 95%EAP30 antibody
<p>EAP30 antibody was raised in rabbit using the N terminal of EAP30 as the immunogen</p>Pureza:Min. 95%ESR1 antibody
<p>ESR1 antibody was raised in rabbit using the C terminal of ESR1 as the immunogen</p>Pureza:Min. 95%Aquaporin 5 antibody
<p>Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.</p>Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>RAGE antibody
<p>RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL</p>DHX32 antibody
<p>DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR</p>PAK2 antibody
<p>The PAK2 antibody is a monoclonal antibody that has antiviral properties. It specifically targets and binds to PAK2, a protein involved in various cellular processes such as cell migration, proliferation, and survival. This antibody can be used for research purposes in the field of Life Sciences to study the role of PAK2 in different biological pathways.</p>FUT6 antibody
<p>FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR</p>Pureza:Min. 95%CYP1A1 antibody
<p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV</p>Pureza:Min. 95%
