Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Pureza:Min. 95%PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
RBM39 antibody
RBM39 antibody was raised using the N terminal of RBM39 corresponding to a region with amino acids ADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSK
Trazodone antibody
The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dysPureza:Min. 95%ADAM19 antibody
ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
Pureza:Min. 95%Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.TCF25 antibody
TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen
Pureza:Min. 95%PNOC antibody
PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
Pureza:Min. 95%ABCC11 antibody
ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Pureza:Min. 95%TRIM32 antibody
The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.
ANTP antibody
ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Pureza:Min. 95%Hamster Lymphocyte antibody
Hamster lymphocyte antibody was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.Pureza:Min. 95%Goat anti Human IgG (Alk Phos)
Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.
Pureza:Min. 95%
