Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30316 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rac GTPase fragment
Rac GTPase, a Rho family peptide, sequence H2N-Val-Phe-Asp-Glu-Ala-Ile-Arg-Ala-Val-OH, MW 1019.15, is a small GTPase signal protein.Fórmula:C46H74N12O14Pureza:98%Cor e Forma:SolidPeso molecular:1019.15Tamapin
Tamapin, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small-conductance Ca(2+)-activated KFórmula:C146H238N44O41S6Pureza:98%Cor e Forma:SolidPeso molecular:3458.11Urumin
CAS:Urumin, a compound with antiviral properties, inhibits human influenza A virus growth, particularly the PR8 strain, with an inhibitory concentration (IC 50) ofFórmula:C129H198N42O35S2Pureza:98%Cor e Forma:SolidPeso molecular:2961.34WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Fórmula:C55H74N10O13SPureza:98%Cor e Forma:SolidPeso molecular:1115.3PR 39 (porcine) acetate
PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.Pureza:98%Cor e Forma:LiquidPeso molecular:N/A16-38-Thymosin β4 (cattle) (TFA)
Thymosin β4 (cattle) TFA is a high-affinity activator of MLCK that operates independently of Ca2+ [1].Fórmula:C120H205F3N32O43Pureza:98%Cor e Forma:SolidPeso molecular:2841.1PYX 1
CAS:PYX 1 is an effective orexigenic peptide.Fórmula:C70H105Cl2N19O16Pureza:98%Cor e Forma:SolidPeso molecular:1539.61APL180
CAS:APL180 (L-4F) is an apolipoprotein A-I mimetic peptide that enhances the anti-inflammatory activity of high-density lipoprotein (HDL). It is applicable for cardiovascular disease research.Fórmula:C114H156N24O28Cor e Forma:SolidPeso molecular:2310.6DT-2 acetate
DT-2 acetate, a selective cGMP-dependent protein kinase (PKG) inhibitor, is a mouse monoclonal antibody targeting canine thymocytes.DT-2 acetate inhibits PKG-catalyzed phosphorylation, reverses 8-Br-cGMP-induced expansion, and can be used to study immune disorders.Fórmula:C124H227N53O25Pureza:99.80%Cor e Forma:SolidPeso molecular:2860.47TAK-683 TFA (872719-49-8 free base)
TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.Fórmula:C66H84F3N17O15Pureza:98%Cor e Forma:SolidPeso molecular:1412.47Ac-DEMEEC-OH
CAS:Ac-DEMEEC-OH is a competitive inhibitor of the HCV NS3 protease with a Ki of 0.6 µM.Fórmula:C29H44N6O16S2Cor e Forma:SolidPeso molecular:796.82Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Fórmula:C100H149N31O23Pureza:98%Cor e Forma:SolidPeso molecular:2153.45vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.Fórmula:C54H95N17O17Pureza:98%Cor e Forma:SolidPeso molecular:1254.44OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Cor e Forma:SolidPeso molecular:1489.596-FAM-AEEAC-SHK TFA
<p>6-FAM-AEEAC-SHK TFA, a peptide neurotoxin derived from Stichodactyla helianthus and conjugated with a fluorescent marker, selectively blocks voltage-gated potassium channels (kv1.1 and kv1.2). By prolonging action potentials, it interferes with neural signal conduction, making it valuable in neuroscience research.</p>Fórmula:C196H295N55O57S7·xCHF3O2Cor e Forma:SolidPeso molecular:4558.23 (free acid)Secretin, porcine TFA (17034-34-3 free base)
Porcine secretin TFA is a 27-amino acid peptide aiding in diagnosing pancreatic and gastric disorders.Fórmula:C132H221N44F3O43Pureza:98%Cor e Forma:SolidPeso molecular:3169.43CLIP (86-100) (TFA) (648881-58-7 free base)
CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.Fórmula:C74H129F3N20O21S3Pureza:98%Cor e Forma:SolidPeso molecular:1788.13Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Fórmula:C52H83N17O15Pureza:98%Cor e Forma:SolidPeso molecular:1186.32immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Fórmula:C54H83N13O13Pureza:98%Cor e Forma:SolidPeso molecular:1122.32type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Fórmula:C47H77N13O15Pureza:98%Cor e Forma:SolidPeso molecular:1064.19β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Fórmula:C49H76N12O15Pureza:98%Cor e Forma:SolidPeso molecular:1073.2Maurocalcine TFA
Maurocalcine TFA acts as an agonist for ryanodine receptor (RyR) channels 1, 2, and 3, demonstrating cell-penetrating capabilities. It induces binding of [3H]ryanodine to RyR1 with an EC50 of 2558 nM and exhibits an apparent affinity of 14 nM for RyR2. This compound is applicable for in vivo cell tracking or other cellular imaging techniques.Fórmula:C156H270N56O46S6·xC2HF3O2Cor e Forma:SolidPeso molecular:3858.55 (free base)ω-Conotoxin CVIB
CAS:ω-Conotoxin CVIB is an antagonist of non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs).Fórmula:C102H173N41O32S7Pureza:98%Cor e Forma:SolidPeso molecular:2710.18Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Fórmula:C32H45N9O10SPureza:98%Cor e Forma:SolidPeso molecular:747.82Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Fórmula:C26H51N3O5Pureza:98%Cor e Forma:SolidPeso molecular:485.7Nictide
CAS:<p>Nictide, a peptide substrate for LRRK2 (leucine-rich repeat protein kinase-2), undergoes phosphorylation by the activated form of LRRK2[G2019S], exhibiting a Km value of 10 μM.</p>Fórmula:C123H193N45O28Cor e Forma:SolidPeso molecular:2750.13Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Cor e Forma:SolidPeso molecular:3692.15RO7196472
CAS:RO7196472 is a potent macrocyclic peptide antibiotic that selectively inhibits the activity of Acinetobacter strains. It targets the lipopolysaccharide (LPS) binding site on the inner membrane's LptB2FG complex, inhibiting lipopolysaccharide transport and thereby suppressing the activity of Acinetobacter strains.Fórmula:C41H49ClN10O3SCor e Forma:SolidPeso molecular:797.41CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Fórmula:C162H262N50O52S2Pureza:98%Cor e Forma:SolidPeso molecular:3806.3cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Fórmula:C126H202N42O40S2Pureza:98%Cor e Forma:SolidPeso molecular:3009.36Suc-AEPF-AMC
CAS:<p>Suc-AEPF-AMC (Suc-Ala-Glu-Pro-Phe-AMC) is a peptide substrate for the peptidyl prolyl isomerases Pin1 and Par14, and is a peptide compound that can be used to assay protease activity.</p>Fórmula:C36H41N5O11Pureza:99.14%Cor e Forma:SoildPeso molecular:719.74FITC-εAhx-HHV-2 Envelope Glycoprotein G (561-578)
CAS:FITC-εAhx-HHV-2 Envelope Glycoprotein G (561-578) is a fluorescein isothiocyanate (FITC)-labeled segment of the HHV-2 Envelope Glycoprotein G encompassing aminoFórmula:C104H128N20O44SPureza:98%Cor e Forma:SolidPeso molecular:2394.3Colistin A
CAS:<p>Colistin A, from Paenibacillus polymyxa, is an antibiotic effective against Gram-negative bacilli, part of the polymyxin class.</p>Fórmula:C53H100N16O13Pureza:98%Cor e Forma:SolidPeso molecular:1169.46Apamin TFA (24345-16-2 free base)
Apamin TFA: bee venom toxin; blocks Ca2+-activated K+ channels (SK, KCa2), strongest on SK2.Fórmula:C81H132F3N31O26S4Pureza:98%Cor e Forma:SolidPeso molecular:2141.36Cyclo(RGDfC) TFA
Zelminemab (AMG-301) is a humanized monoclonal antibody targeting ADCYAP1R1 for use in neurological disorders.Fórmula:C26H35F3N8O9SPureza:98.59%Cor e Forma:SolidPeso molecular:692.67HIV-1 TAT (48-60) Acetate
Lilotomab (HH1) is a murine anti-CD37 antibody that can be used to synthesize anti-CD37 antibody-radionuclide couplings.Fórmula:C72H135N35O18Pureza:99.93%Cor e Forma:SoildPeso molecular:1779.07Jingzhaotoxin-X
Jingzhaotoxin-X (JZTX-X) selectively inhibits Kv4.2 and Kv4.3 potassium channels, resulting in prolonged mechanical hyperalgesia [1].Fórmula:C164H242N46O41S6Pureza:98%Cor e Forma:SolidPeso molecular:3706.35TKD (450-463)
CAS:TKD (450-463), a 14-peptide (TKDNNLLGRFELSG), exhibits the ability to stimulate NK cells' cytolytic and proliferative activities at concentrations comparable to the full-length Hsp70 protein.Fórmula:C67H110N20O23Cor e Forma:SolidPeso molecular:1563.71C-Peptide 2, rat acetate
C-Peptide 2, rat acetate is a proinsulin component of inhibiting glucose-induced insulin secretion, consisting of acetate and a polypeptide composed of 31 aminoFórmula:C137H226N38O51Pureza:98%Cor e Forma:SolidPeso molecular:3221.48pYEEI
<p>pYEEI, a tetrapeptide containing phosphotyrosine, binds to the SrcSH2 domain with a dissociation constant (Kd) of 100 nM and an inhibitory concentration (IC50) of 6.5 μM. This compound plays a crucial role in cancer research.</p>Fórmula:C25H36N3O14PCor e Forma:SolidPeso molecular:633.54Parasin I (TFA)(219552-69-9,free)
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity[1].Fórmula:C82H154N34O24·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:2114.33signal transducer and activator of transcription 6 fragment
The signal transducer and activator of transcription 6 fragments is a peptide with the sequence H2N-Ser-Tyr-Trp-Ser-Asp-Arg-Leu-Ile-Ile-OH, MW= 1152.3.Fórmula:C54H81N13O15Pureza:98%Cor e Forma:SolidPeso molecular:1152.3Apelin-13 TFA (217082-58-1 free base)
Apelin-13 is an endogenous ligand of APJ receptor, and the EC 50 value of activated G protein coupled receptor is 0.37 nM.Fórmula:C71H112F3N23O18SPureza:98%Cor e Forma:SolidPeso molecular:1664.85FA-Ala-Arg
CAS:FA-Ala-Arg is a dipeptide featuring a furylacryloyl group that degrades to yield arginine.Fórmula:C16H23N5O5Pureza:98%Cor e Forma:SolidPeso molecular:365.38BMAP-28
CAS:BMAP-28, an antibiotic peptide, induces cell death by triggering the mitochondrial permeability transition pore and serves as a research tool in the study ofFórmula:C145H250N44O29Pureza:98%Cor e Forma:SolidPeso molecular:3073.81Fibronectin Adhesion-promoting Peptide TFA
Fibronectin peptide aids MSC aggregation by heparin-binding, promoting spheroid assembly.Fórmula:C49H75F3N16O12Pureza:98%Cor e Forma:SolidPeso molecular:1137.22Laminin (925-933)(TFA) (110590-60-8 free base)
Laminin (925-933) (TFA) is a peptide derived from residues 925-933 of the Laminin B1 chain that binds to the laminin receptor.Fórmula:C42H63F3N12O16SPureza:98%Cor e Forma:SolidPeso molecular:1081.08HiBiT tag
CAS:The HiBiT tag, a complementary peptide (VSGWRLFKKIS), exhibits high affinity for LgBiT. It is fused with the Gβ subunit of the receptor. The interaction between LgBiT and HiBiT facilitates the stabilization of ETR and G proteins. Additionally, HiBiT can be attached to target proteins (GFP) to quantify their transport to the cytosol.Fórmula:C63H101N17O14Cor e Forma:SolidPeso molecular:1320.58Ceratotoxin-2
CAS:<p>Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel inhibitor, demonstrating half maximal inhibitory concentrations (IC50) of 8 nM for Na v 1.2/β 1 and 88</p>Fórmula:C177H260N52O49S6Pureza:98%Cor e Forma:SolidPeso molecular:4092.67DfTat
CAS:DfTat, a fluorescently-labeled TAT peptide dimer, effectively facilitates the intracellular delivery of small molecules, peptides, and proteins into live cellsFórmula:C178H292N74O34S2Cor e Forma:SolidPeso molecular:4074.28363Leu-Val
CAS:Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Fórmula:C11H22N2O3Pureza:99.32%Cor e Forma:SolidPeso molecular:230.3Super Fluor 488, SE
Super Fluor 488, SE is a dye for labeling biomolecules, offering high-brightness and sensitivity without self-quenching.Pureza:98%Cor e Forma:SolidPeso molecular:N/ACCP peptide
CAS:CCP peptide is a synthetic cyclic peptide incorporating the amino acid citrulline.Fórmula:C87H145N41O32S2Pureza:98%Cor e Forma:SolidPeso molecular:2341.47EC-1456
CAS:<p>EC-1456 is a folate-microtubule targeting agent that exhibits significant antiproliferative activity against folate receptor (FR) positive tumors, including models resistant to anticancer drugs. EC-1456 is utilized in cancer research.</p>Fórmula:C110H165N23O45S3Cor e Forma:SolidPeso molecular:2625.81PKCθ pseudosubstrate peptide inhibitor,myristoylated
Myristoylated PKCθ pseudosubstrate peptide inhibitor is a synthetic peptide utilized to investigate the mechanism of action of protein kinase C theta (PKCθ) [1Fórmula:C105H184N36O21SPureza:98%Cor e Forma:SolidPeso molecular:2318.88C-Reactive Protein (CRP) (201-206)
CAS:<p>C-Reactive Protein (CRP) (201-206) is the peptide fragment of C-Reactive Protein. CRP is a cardiovascular risk marker and may promote atherogenesis.</p>Fórmula:C38H57N9O8Pureza:98%Cor e Forma:SolidPeso molecular:767.91Ac-IEVDID (TFA)
Ac-IEVDID TFA is a short peptide sequence with Ac at the end.Fórmula:C34H53F3N6O16Pureza:98%Cor e Forma:SolidPeso molecular:858.81Antennapedia Peptide
CAS:Antennapedia Peptide: 16-mer from Drosophila domain, induces cellular uptake.Fórmula:C104H168N34O20SPureza:98%Cor e Forma:SolidPeso molecular:2246.8Jingzhaotoxin-XII
<p>Jingzhaotoxin-XII (JzTx-XII) functions as a potent inhibitor of the Kv4.1 channel, exhibiting an inhibitory concentration (IC50) of 0.363 μM.</p>Fórmula:C161H227N41O44S7Pureza:98%Cor e Forma:SolidPeso molecular:3665.23X-press Tag Peptide
X-press Tag: an N-terminal peptide with polyhistidine, T7 gene 10 Xpress epitope, and enterokinase site, detected by anti-Xpress antibodies.Fórmula:C41H59N9O20Pureza:98%Cor e Forma:SolidPeso molecular:997.96Bz-Ala-Arg
CAS:Bz-Ala-Arg, a dipeptide, serves as a spectrophotometric substrate (0.4 M pyridine formate, pH 4.25) for human pancreatic carboxypeptidase B and plasmaFórmula:C16H23N5O4Pureza:98%Cor e Forma:SolidPeso molecular:349.38Hemitoxin
Hemitoxin, a scorpion-venom peptide, functions as a K+ channel blocker and selectively inhibits rat Kv1.1, Kv1.2, and Kv1.3 channels expressed in XenopusFórmula:C159H259N49O49S8Pureza:98%Cor e Forma:SolidPeso molecular:3897.58m3-Huwentoxin IV
m3-Huwentoxin IV (m3-HwTx-IV) is a potent inhibitor of sodium channels (NaV), exhibiting half-maximal inhibitory concentrations (IC50s) of 3.3 nM for hNaV1.7, 6Fórmula:C170H271N53O46S6Pureza:98%Cor e Forma:SolidPeso molecular:3985.69µ-Conotoxin BuIIIC
CAS:μ-Conotoxin BuIIIC (Mu-Conotoxin BuIIIC) effectively inhibits the NaV1.4 sodium channel [1].Fórmula:C116H189N49O34S6Pureza:98%Cor e Forma:SolidPeso molecular:3006.44Type A Allatostatin I
CAS:Type A Allatostatin I: tridecapeptide, inhibits juvenile hormone synthesis in insects, pleiotropic neuropeptide.Fórmula:C61H94N18O16Pureza:98%Cor e Forma:SolidPeso molecular:1335.51Ac-IEVDIDVEH (TFA)
<p>Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.</p>Fórmula:C50H76F3N11O21Pureza:98%Cor e Forma:SolidPeso molecular:1224.19Neuronostatin-13 human acetate
Neuronostatin-13 human acetate is a 13-amino acid peptide hormone, which plays an important role in the regulation of hormonal and cardiac function.Fórmula:C66H114N20O18Pureza:98%Cor e Forma:SolidPeso molecular:1475.73Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Fórmula:C172H263N43O52·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:3879.27Beefy meaty peptide
CAS:Beefy meaty peptide is a bioactive chemical.Fórmula:C34H57N9O16Pureza:98%Cor e Forma:SolidPeso molecular:847.87HBcAg [Hepatitis B virus] (18-27)
HBcAg indicates active Hep B replication—suggests high transmission risk.Fórmula:C58H78N10O15Pureza:98%Cor e Forma:SolidPeso molecular:1155.3Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
Acetyl-PHF6 amide TFA is a tau derived hexapeptide.Fórmula:C40H64F3N9O11Pureza:98%Cor e Forma:SolidPeso molecular:903.99CRF, bovine TFA (92307-52-3 free base)
CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.Fórmula:C208H341F3N60O65SPureza:98%Cor e Forma:SolidPeso molecular:4811.36Tetrapeptide-5
CAS:Tetrapeptide-5 is a humectant or hydroscopic moisturizer.Fórmula:C18H26N8O6Pureza:98%Cor e Forma:SolidPeso molecular:450.45RAD17-derived Peptide TFA
RAD17-derived peptide, a substrate for the ataxia-telangiectasia and RAD3-related protein/kinase (ATR), facilitates the identification of ATR inhibitors.Fórmula:C81H132N22O25·XCF3COOHCor e Forma:SolidPeso molecular:1814.10Tetrapeptide-2
CAS:<p>Tetrapeptide-2 is an amino acid peptide.</p>Fórmula:C24H37N5O8Pureza:98%Cor e Forma:SolidPeso molecular:523.58Lys-phe-phe-phe-ile-ile-trp-och3
CAS:Lys-phe-phe-phe-ile-ile-trp-och3 is a hydrophobic peptide which reacts with lipid vesicles.Fórmula:C57H75N9O8Pureza:98%Cor e Forma:SolidPeso molecular:1014.26Lactoferrin (17-41) TFA (146897-68-9 free base)
Lactoferricin B (amino acids 17-41 of lactoferrin) enhances anti-fungal agents against Candida Albicans.Fórmula:C143H225F3N46O31S3Pureza:98%Cor e Forma:SolidPeso molecular:3237.79Adipokinetic Hormone (AKH) (24-32), locust
CAS:Adipokinetic Hormone (AKH) (24-32), locust is a peptide hormone isolated from locusts.Fórmula:C54H74N14O15Pureza:98%Cor e Forma:SolidPeso molecular:1159.27Knqdk peptide
CAS:Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.Fórmula:C25H45N9O10Pureza:98%Cor e Forma:SolidPeso molecular:631.68HPV16 E7 (86-93) acetate
HPV16 E7 (86-93) acetate is a derived peptide of human leukocyte antigen A2.1 restricted HPV16 E7 with immunogenic property in cervical carcinomas.Fórmula:C39H70N8O12SPureza:96.9100%Cor e Forma:SolidPeso molecular:875.08Catestatin acetate
Catestatin acetate is a non-competitive antagonist of nAChR and inhibits catecholamine release.Fórmula:C109H177N37O28SPureza:99.28%Cor e Forma:SolidPeso molecular:2485.87TNF-α (10-36), human (TFA) (144796-70-3 free base)
TNF-α (10-36), human (TFA) is a peptide of human TNF-α.Fórmula:C133H212N43O40Pureza:98%Cor e Forma:SolidPeso molecular:3110.36Laminin (925-933) acetate
Laminin (925-933) acetate is derived from the Laminin B1 chain that binds to the laminin receptor.Fórmula:C42H66N12O16SPureza:97.49%Cor e Forma:SolidPeso molecular:1027.11O-(1H-6-Chlorobenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
CAS:Fórmula:C11H15ClF6N5OPPureza:≥ 99.0%Cor e Forma:White to off-white crystalline powderPeso molecular:413.69Trifluoroacetic acid
CAS:Fórmula:CF3CO2HPureza:(Titration) ≥ 99.0%Cor e Forma:Clear, colourless to faint yellow liquidPeso molecular:114.02Benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate
CAS:Fórmula:C18H28N6OP·PF6Pureza:≥ 97.5%Cor e Forma:White to off-white or slightly yellow crystalline powderPeso molecular:520.40EDC hydrochloride
CAS:Fórmula:C8H17N3·HClPureza:(HPLC) ≥ 98.0%Cor e Forma:White to off-white crystalline powderPeso molecular:191.70BDS I
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels.Fórmula:C210H297N57O56S6Pureza:98%Cor e Forma:SolidPeso molecular:4708.37Nucleoprotein (118-126)
CAS:Nucleoprotein (118-126),a fragment of Nucleoprotein, is a 9-aa peptide .Fórmula:C43H69N13O13SPureza:98%Cor e Forma:SolidPeso molecular:1008.15µ-Conotoxin-CnIIIC acetate
µ-Conotoxin-CnIIIC acetate is a NaV1.4 sodium channel antagonist, a conotoxin peptide consisting of 22 amino acids, used for muscle relaxation and pain relief.Fórmula:C92H139N35O28S6·xC2H4O2Pureza:99.94%Cor e Forma:SolidPeso molecular:2375.70 (free base)6-CR110 Single isomer
CAS:<p>6-CR110 Single isomer is a rhodamine-class green fluorescent dye with ex/em=499/525 nm for DNA or protein labelling and cell staining.</p>Fórmula:C21H15N2O5ClPureza:98%Cor e Forma:SolidPeso molecular:410.81Biotin-Crosstide TFA
Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.Fórmula:C58H91N19O19S·XCF3COOHCor e Forma:SolidPeso molecular:1390.53α-Conotoxin Vc1.1 TFA
α-Conotoxin Vc1.1 TFA is a peptide isolated from Conus victoriae and is also a nAChR antagonist that can be used to study neuropathic chronic pain.Fórmula:C73H108F3N23O27S4Pureza:97.57%Cor e Forma:SolidPeso molecular:1925.03APP-018
CAS:APP-018 (D-4F) is an 18 D-amino acid peptide that mimics apolipoprotein A-I (apoA-I). It enhances the anti-inflammatory properties of high-density lipoprotein (HDL) and is applicable in cardiovascular disease research.Fórmula:C114H156N24O28Cor e Forma:SolidPeso molecular:2310.6KKI-5 TFA(97145-43-2 free base)
KKI-5 (TFA) is a specific tissue kallikrein inhibitor.Kki-5 (TFA) can reduce breast cancer cell infiltration.Fórmula:C37H56F3N11O11Pureza:98%Cor e Forma:SolidPeso molecular:887.9S1b3inL1
CAS:S1b3inL1 is a macrocylcic peptide inhibitor of the SARS-CoV-2 spike protein. It binds with high affinity to a conserved site on the spike protein, effectively suppressing the infection of various SARS-CoV-2 variants. S1b3inL1 exhibits antiviral activity.Fórmula:C103H158N30O24SCor e Forma:SolidPeso molecular:2232.61α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Fórmula:C43H57N9O11Pureza:98%Cor e Forma:SolidPeso molecular:875.97Valylvaline
CAS:Valylvaline (Val-val) is a dipeptide compound that can be used for protein synthesis.Fórmula:C10H20N2O3Pureza:99.67%Cor e Forma:SolidPeso molecular:216.28Fmoc-Asp-OAll
CAS:Fmoc-Asp-OAll (Fmoc-L-aspartic acid a-allyl ester) is an aspartic acid derivative.Fórmula:C22H21NO6Pureza:98.31%Cor e Forma:SolidPeso molecular:395.41
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![HBcAg [Hepatitis B virus] (18-27)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2231.webp&w=3840&q=75)
