Peptídeos
Os peptídeos são cadeias curtas de aminoácidos ligados por ligações peptídicas, desempenhando papéis importantes como moléculas biológicas em processos celulares. Eles funcionam como hormônios, neurotransmissores e moléculas de sinalização, sendo amplamente utilizados em aplicações terapêuticas e diagnósticas. Os peptídeos também são cruciais na pesquisa para estudar interações proteicas, atividades enzimáticas e vias de sinalização celular. Na CymitQuimica, oferecemos uma ampla seleção de peptídeos de alta qualidade para apoiar suas necessidades de pesquisa e desenvolvimento em biotecnologia e farmacêutica.
Subcategorias de "Peptídeos"
Foram encontrados 30318 produtos de "Peptídeos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Angiotensinogen (1-14), human acetate
Angiotensinogen (1-14), human acetate is a fragment of angiotensinogen which is a passive substrate of the renin-angiotensin system.Fórmula:C85H126N24O21Pureza:98.4%Cor e Forma:SolidPeso molecular:1820.06Nucleoprotein (118-126)
CAS:Nucleoprotein (118-126),a fragment of Nucleoprotein, is a 9-aa peptide .Fórmula:C43H69N13O13SPureza:98%Cor e Forma:SolidPeso molecular:1008.15ω-Conotoxin CnVIIA
CAS:ω-Conotoxin CnVIIA, a 27-amino-acid neuropeptide toxin, serves as an N-type calcium current blocker [1].Fórmula:C110H179N39O36S7Pureza:98%Cor e Forma:SolidPeso molecular:2848.29Uty HY Peptide (246-254)
CAS:Uty HY Peptide (246-254) is a male-specific antigen from Y chromosome H-YDB gene.Fórmula:C53H77N15O13S2Pureza:98%Cor e Forma:SolidPeso molecular:1196.4Ac-LETD-AFC
CAS:Ac-LETD-AFC is a fluorescent substrate that can be specifically cleaved by caspase-8. λEx(nm) of Ac-LETD-AFC is 400 nm and λEm is 505 nm.Fórmula:C31H38F3N5O12Pureza:99.67%Cor e Forma:SolidPeso molecular:729.65Prepro VIP (111-122), human
CAS:Prepro VIP (111-122), human is a prepro-vasoactive intestinal polypeptide (VIP)–derived peptide, corresponding to residues 111-122.Fórmula:C53H87N13O21Pureza:98%Cor e Forma:SolidPeso molecular:1242.33Orexin B, human TFA (205640-91-1 free base)
<p>Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.</p>Fórmula:C123H212N44O35S·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:3013.36Parasin I (TFA)(219552-69-9,free)
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity[1].Fórmula:C82H154N34O24·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:2114.33Calpastatin subdomain B
CAS:<p>Calpastatin subdomain B is a bioactive peptide that inhibits calpain activity.</p>Fórmula:C140H227N35O44SPureza:98%Cor e Forma:SolidPeso molecular:3136.57Ac-FEID-CMK TFA
Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.Fórmula:C29H38ClF3N4O11Pureza:95%Cor e Forma:SolidPeso molecular:711.08InsB 9-23
<p>InsB (9-23) is an insulin B-chain peptide that binds to a class II histocompatibility complex (MHC) allele called I-Ag7.</p>Fórmula:C72H116N20O22S1Pureza:98%Cor e Forma:SolidPeso molecular:1645.9PEN(mouse)
CAS:Endogenous peptide GPR83 agonist. ProSAAS-derived neuropeptide. Activates phospholipase C (PLC)-mediated signaling cascade in mouse hypothalamus.Fórmula:C102H169N27O34Pureza:98%Cor e Forma:SolidPeso molecular:2317.62Leucopyrokinin
CAS:Leucopyrokinin is a myotropic neuropeptide.Fórmula:C42H66N12O12Pureza:98%Cor e Forma:SolidPeso molecular:931.05C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Fórmula:C37H62F3N13O12Pureza:98%Cor e Forma:SolidPeso molecular:937.96[Des-octanoyl]-Ghrelin (human)
CAS:[Des-octanoyl]-Ghrelin (human) is a Non-acylated, major circulating isoform of ghrelin.Fórmula:C141H235N47O41Pureza:98%Cor e Forma:SolidPeso molecular:3244.66ShK toxin
CAS:ShK toxin, isolated from the Caribbean sea anemone (Stichodactyla helianthus), is an inhibitor of the voltage-dependent potassium channel (Kv1.3 channel).Fórmula:C169H274N54O48S7Pureza:98%Cor e Forma:SolidPeso molecular:4054.8PKCθ pseudosubstrate peptide inhibitor,myristoylated
<p>Myristoylated PKCθ pseudosubstrate peptide inhibitor is a synthetic peptide utilized to investigate the mechanism of action of protein kinase C theta (PKCθ) [1</p>Fórmula:C105H184N36O21SPureza:98%Cor e Forma:SolidPeso molecular:2318.88Suc-AEPF-AMC
CAS:<p>Suc-AEPF-AMC (Suc-Ala-Glu-Pro-Phe-AMC) is a peptide substrate for the peptidyl prolyl isomerases Pin1 and Par14, and is a peptide compound that can be used to assay protease activity.</p>Fórmula:C36H41N5O11Pureza:99.14%Cor e Forma:SoildPeso molecular:719.74MCA-SEVNLDAEFR-K(Dnp)-RR, amide
CAS:<p>MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.</p>Fórmula:C86H125N27O29Pureza:98%Cor e Forma:SolidPeso molecular:2001.08C-telopeptide acetate
C-telopeptide acetate is a cross-linked peptide of type I collagen and can be used as a marker for bone resorption.Fórmula:C36H60N14O15Pureza:98%Cor e Forma:SolidPeso molecular:928.95Protein Kinase C (19-31) (TFA)(121545-65-1,free)
Protein Kinase C (19-31) TFA is a serine-modified PKCa-derived inhibitor for testing PKC activity.Fórmula:C69H119F3N26O18Pureza:98%Cor e Forma:SolidPeso molecular:1657.84SNAP8
CAS:SNAP8 (Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-Nh2) is a mimic of the N-terminal end of SNAP-25 which competes with SNAP-25 for a position in the SNARE complex,Fórmula:C41H70N16O16SPureza:98%Cor e Forma:SolidPeso molecular:1075.16Nifalatide
CAS:<p>Nifalatide is a analog of enkephalin.</p>Fórmula:C30H39N7O9SPureza:98%Cor e Forma:SolidPeso molecular:673.74Lqvtdsglyrcviyhpp TFA
Lqvtdsglyrcviyhpp TFA is a TREM-1 inhibitor with potential anticancer activity and can be used to study skin and pancreatic cancer.Fórmula:C91H138F3N23O27SPureza:95%Cor e Forma:SolidPeso molecular:2075.27Interphotoreceptor Retinoid Binding Protein Fragment (IRBP)
CAS:IRBP Fragment is a 20-residue peptide in IRBP 161-180, causing post-uveitis (EAU).Fórmula:C103H157N25O29Pureza:98%Cor e Forma:SolidPeso molecular:2209.5α-1 antitrypsin fragment
A1AT is a serum protease inhibitor, a 394-amino acid glycoprotein with multiple glycoforms, belonging to the serpin family.Fórmula:C79H130N22O26Pureza:98%Cor e Forma:SolidPeso molecular:1804.01Davunetide acetate
<p>Davunetide acetate is derived from activity-dependent neuroprotective protein existing in the mammalian CNS.</p>Fórmula:C38H64N10O14Pureza:99.52% - 99.78%Cor e Forma:SolidPeso molecular:884.97mHuwentoxin-IV
mHuwentoxin-IV, a naturally modified form of Huwentoxin-IV, selectively inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels in dorsal rootFórmula:C174H276N52O50S6Pureza:98%Cor e Forma:SolidPeso molecular:4088.76V5 Epitope Tag Peptide
V5 epitope: 95GKPIPNPLLGLDST108 from simian parainfluenza virus 5 polymerase α, chosen for its high-affinity antibody production.Fórmula:C64H108N16O20Pureza:98%Cor e Forma:SolidPeso molecular:1421.64C-Peptide, dog
CAS:Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.Fórmula:C137H225N37O49Pureza:98%Cor e Forma:SolidPeso molecular:3174.47Z-Asp(OBzl)-OH
CAS:Z-Asp(OBzl)-OH (N-Cbz-L-Aspartic acid 4-benzyl ester) is an aspartic acid derivative.Fórmula:C19H19NO6Pureza:98.71%Cor e Forma:SolidPeso molecular:357.36RETF-4NA acetate
RETF-4NA acetate is a sensitive, specific substrate for chymotrypsin.Fórmula:C34H47N9O12Pureza:97.6400%Cor e Forma:SolidPeso molecular:773.79Quinupristin-Dalfopristin Complex (mesylate)
Quinupristin-dalfopristin is a synergistic streptogramin antibiotic combo, with types A (Dalfopristin) & B (Quinupristin).Fórmula:C34H51N4O9SCH3SO3·C53H68N9O10SCH3SO3Pureza:98%Cor e Forma:SolidPeso molecular:1905.3Gly-Phe β-naphthylamide acetate
Gly-Phe β-naphthylamide acetate is the substrate of Cathepsin C and can be used for research on the function of cathepsin C, intralysosomal hydrolysis andFórmula:C23H25N3O4Pureza:99.56%Cor e Forma:SolidPeso molecular:407.46Pressinoic Acid
CAS:Pressinoic Acid is a peptide with potent corticotrophin-releasing activity. It is also an oxytocin inhibitor; it induces maternal behavior.Fórmula:C33H42N8O10S2Pureza:98%Cor e Forma:SolidPeso molecular:774.86Recanaclotide
CAS:Recanaclotide can be used to treat Gastroparesis, Functional Dyspepsia, and Other Gastrointestinal Disorders.Fórmula:C45H71N14O20PS6Pureza:98%Cor e Forma:SolidPeso molecular:1351.49PTPσ Inhibitor, ISP
PTPσ Inhibitor ISP is a compound that binds to recombinant human PTPs, thereby inhibiting PTPσ signaling.Fórmula:C177H306N66O54S3Pureza:98%Cor e Forma:SolidPeso molecular:4318.93[Arg8]-Vasotocin TFA (113-80-4 free base)
[Arg8]-Vasotocin (TFA) is a nonmammalian vertebrate neurohypophyseal peptide.Fórmula:C45H68F3N15O14S2Pureza:98%Cor e Forma:SolidPeso molecular:1164.24TNF-α (31-45), human TFA (144796-71-4 free base)
<p>TNF-α (31-45), human (TFA) is a peptide of tumor necrosis factor-α.</p>Fórmula:C71H123F3N26O24Pureza:98%Cor e Forma:SolidPeso molecular:1781.89Peptide M acetate
Peptide M acetate is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen:Fórmula:C83H145N21O33Pureza:98.96%Cor e Forma:SolidPeso molecular:1965.16GLGPNPCRKKCYKRDFLGR
GLGPNPCRKKCYKRDFLGR is a synthetic peptide.Fórmula:C96H158N32O24S2Pureza:98%Cor e Forma:SolidPeso molecular:2208.64Histone-H2A-(107-122)-Ac-OH
Histone-H2A-(107-122)-Ac-OH, a peptide with MW=1762.1, helps package DNA in eukaryotic chromatin.Fórmula:C81H140N20O23Pureza:98%Cor e Forma:SolidPeso molecular:1762.1NEP(1-40)
CAS:<p>Nogo-66 (1–40) peptide blocks NgR, enhances axonal growth, and aids spinal recovery, but doesn't affect MAG inhibition.</p>Fórmula:C206H324N56O65Pureza:98%Cor e Forma:SolidPeso molecular:4625.16Cucumechinoside D
CAS:Cucumechinoside D is a natural bioactive chemical.Fórmula:C54H84O32S3Pureza:98%Cor e Forma:SolidPeso molecular:1341.41Small cardioactive peptide A
CAS:Small cardioactive peptide A modulates neuromuscular connections and feeding behavior in molluscs as a cotransmitter.Fórmula:C59H92N18O12SPureza:98%Cor e Forma:SolidPeso molecular:1277.54EGFRvIII peptide PEPvIII acetate
EGFRvIII peptide PEPvIII acetate, a tumor-specific mutation, is prevalent in GBM and other cancers, increasing tumorigenicity.Fórmula:C72H115N19O26SPureza:96.21%Cor e Forma:SolidPeso molecular:1694.86Flagelin 22 acetate
Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.Fórmula:C95H166N32O36Pureza:95.93%Cor e Forma:SolidPeso molecular:2332.56RO27-3225 TFA (274682-89-2 free base)
RO27-3225 TFA: potent MC4R agonist (EC50: 1 nM), 30x more selective than MC3R, neuroprotective, anti-inflammatory.Fórmula:C41H53F3N12O8Pureza:98%Cor e Forma:SolidPeso molecular:898.93Conopressin S
CAS:Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Fórmula:C41H73N17O10S2Pureza:98%Cor e Forma:SolidPeso molecular:1028.26BCMA72-80
CAS:<p>BCMA72-80: HLA-A2-specific peptide with high affinity; used in multiple myeloma and other BCMA+ tumor research.</p>Fórmula:C59H97N13O11SPureza:98%Cor e Forma:SolidPeso molecular:1196.55GO-203 acetate
GO-203 acetate is an effective inhibitor of potent MUC1-C oncoprotein. GO-203 acetate exhibits anti-cancer activities targeting intracellular proteins.Fórmula:C91H175F3N52O23S2Pureza:98.86%Cor e Forma:SolidPeso molecular:2486.82TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
TAT-DEF-Elk-1 TFA: a peptide that inhibits Elk-1, blocking its phosphorylation and nuclear entry, without affecting ERK/MSK1.Fórmula:C157H260N57F3O42Pureza:98%Cor e Forma:SolidPeso molecular:3675.09Pam2CSK4 Biotin
biotinylated Pam2CSK4, a toll-like receptor 2/6 agonistFórmula:C87H162N14O16S2Pureza:98%Cor e Forma:SolidPeso molecular:1724.44Leu-Val
CAS:Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Fórmula:C11H22N2O3Pureza:99.32%Cor e Forma:SolidPeso molecular:230.3Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Fórmula:C20H28F3N3O8Pureza:98%Cor e Forma:SolidPeso molecular:495.45SPR741 TFA (1179330-52-9 free base)
<p>SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.</p>Fórmula:C46H74F3N13O15Pureza:98%Cor e Forma:SolidPeso molecular:1106.15vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.Fórmula:C54H95N17O17Pureza:98%Cor e Forma:SolidPeso molecular:1254.44immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Fórmula:C54H83N13O13Pureza:98%Cor e Forma:SolidPeso molecular:1122.32MAGE-A3 (195-203)
CAS:MAGE-3/HLA-A24 is a strong MHC-binding peptide, promising for immunotherapy in MAGE-3+ tumors.Fórmula:C45H82N10O10SPureza:98%Cor e Forma:SolidPeso molecular:955.3Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Fórmula:C26H51N3O5Pureza:98%Cor e Forma:SolidPeso molecular:485.7Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Fórmula:C32H45N9O10SPureza:98%Cor e Forma:SolidPeso molecular:747.82cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Fórmula:C126H202N42O40S2Pureza:98%Cor e Forma:SolidPeso molecular:3009.36CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Fórmula:C162H262N50O52S2Pureza:98%Cor e Forma:SolidPeso molecular:3806.3DSTYSLSSTLTLSK acetate
<p>DSTYSLSSTLTLSK acetate is a human generic peptide that can be used for the quantitative detection of infliximab.</p>Fórmula:C66H111N15O28Pureza:98%Cor e Forma:SolidPeso molecular:1562.67β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Fórmula:C49H76N12O15Pureza:98%Cor e Forma:SolidPeso molecular:1073.2Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Fórmula:C100H149N31O23Pureza:98%Cor e Forma:SolidPeso molecular:2153.45type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Fórmula:C47H77N13O15Pureza:98%Cor e Forma:SolidPeso molecular:1064.19TAK-683 TFA (872719-49-8 free base)
TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.Fórmula:C66H84F3N17O15Pureza:98%Cor e Forma:SolidPeso molecular:1412.47OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Cor e Forma:SolidPeso molecular:1489.59Crustacean Cardioactive Peptide Acetate
CCAP acetate, a widespread neuropeptide in arthropods, is a cyclic hormone produced in insect neurons.Fórmula:C44H62N10O14S2Pureza:99.56%Cor e Forma:SolidPeso molecular:1019.15CLIP (86-100) (TFA) (648881-58-7 free base)
CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.Fórmula:C74H129F3N20O21S3Pureza:98%Cor e Forma:SolidPeso molecular:1788.13Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Cor e Forma:SolidPeso molecular:3692.15Conotoxin GII
CAS:Conotoxin GII is a highly toxic peptide.Fórmula:C57H81N19O16S4Pureza:98%Cor e Forma:SolidPeso molecular:1416.63Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Fórmula:C44H71N11O12S2Pureza:98%Cor e Forma:SolidPeso molecular:1010.23Trempamotide
CAS:Trempamotide is a bioactive chemical.Fórmula:C58H80N10O18Pureza:98%Cor e Forma:SolidPeso molecular:1205.31Pfaffoside B
CAS:Pfaffoside B is a nortriterpenoid saponin.Fórmula:C68H110O33Pureza:98%Cor e Forma:SolidPeso molecular:1455.595M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Fórmula:C70H91N15O27Pureza:98%Cor e Forma:SolidPeso molecular:1574.56Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Fórmula:C59H92F3N19O14Pureza:98%Cor e Forma:SolidPeso molecular:1348.48Ceratotoxin A acetate
Ceratotoxin A acetate is isolated from the accessory gland secretion fluid, with anti-bacterial effects.Fórmula:C137H247N35O34Pureza:98.49%Cor e Forma:SolidPeso molecular:2928.64Cholecystokinin pentapeptide
CAS:Cholecystokinin pentapeptide is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.Fórmula:C31H39N7O7SPureza:98%Cor e Forma:SolidPeso molecular:653.75Allatostatin II
CAS:<p>Allatostatin II is an Inhibitors of juvenile hormone synthesis in insects.</p>Fórmula:C49H74N14O13Pureza:98%Cor e Forma:SolidPeso molecular:1067.2Asp-Asp-Asp-Asp-Asp
CAS:<p>Asp-Asp-Asp-Asp-Asp is a peptide consists of 5 Asp.</p>Fórmula:C20H27N5O16Pureza:98%Cor e Forma:SolidPeso molecular:593.45transferrin fragment
Transferrin: primary animal serum iron-binder, similar to lactoferrin, ~80k Da, two-lobed glycoprotein, each lobe has one metal site.Fórmula:C75H121N23O28SPureza:98%Cor e Forma:SolidPeso molecular:1824.97Calcitonin, eel TFA (57014-02-5 free base)
Calcitonin,eel TFA is a thyroid hormone polypeptide that can regulate calcium homeostasis and is widely used in the study of postmenopausal osteoporosis.Fórmula:C148H242F3N43O49S2Pureza:98%Cor e Forma:SolidPeso molecular:3528.89Sperm acrosomal peptide P23
CAS:Sperm acrosomal peptide P23 is a peptide obtained from sperm acrosomal protein.Fórmula:C31H59N9O7Pureza:98%Cor e Forma:SolidPeso molecular:669.86Fmoc-Cys(Acm)-OH
CAS:<p>Fmoc-Cys(Acm)-OH (Fmoc-S-acetamidomethyl-L-cysteine) is a cysteine derivative.</p>Fórmula:C21H22N2O5SPureza:99.89%Cor e Forma:SolidPeso molecular:414.47β-amyloid (12-28) (TFA) (107015-83-8 free base)
β-amyloid (12-28) TFA, a peptide fragment of β-amyloid protein (β1-42), is the major component of senile plaque cores.Fórmula:C91H136N25F3O27Pureza:98%Cor e Forma:SolidPeso molecular:2069.2ACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Fórmula:C75H106N20O19SPureza:98%Cor e Forma:SolidPeso molecular:1623.83TP508 TFA (121341-81-9 free base)
TP508 TFA, a thrombin peptide, activates eNOS in endothelial cells, boosting NO production and tissue regeneration.Fórmula:C99H147N28F3O38SPureza:98%Cor e Forma:SolidPeso molecular:2426.46ACTH (22-39) acetate
ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.Fórmula:C92H129N19O34Pureza:98.14%Cor e Forma:SolidPeso molecular:2045.12Melittin Acetate
<p>Melittin Acetate, a PLA2 activator, enhances low-weight PLA2 activity but not high-weight PLA2.</p>Fórmula:C133H233N39O33Pureza:99.78%Cor e Forma:SoildPeso molecular:2906.51NocII
CAS:Orphan neuropeptide,stimulates locomotion in miceFórmula:C92H141N23O28S2Pureza:98%Cor e Forma:SolidPeso molecular:2081.37Super-TDU (1-31) TFA
<p>Super-tdu (1-31) TFA is an endogenous ligand of heptapeptide receptor and has a strong anti-analgesic effect.</p>Fórmula:C141H218N40O48·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:3355.5MARCKS Peptide(151-175), Phosphorylated
<p>Myristoylated Alanine-Rich C Kinase Substrate peptide (151-175) is a high affinity Protein Kinase C substrate.</p>Fórmula:C147H246N41O40P3Pureza:98%Cor e Forma:SolidPeso molecular:3320.8Deapio platycodin D
Deapio platycodin D is extracted from Platycodon grandiforus.Fórmula:C52H84O24Pureza:98%Cor e Forma:SolidPeso molecular:1092.32CysHHC10 TFA(1408311-03-4 free base)
CysHHC10 TFA is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria.Fórmula:C79H108F3N23O12SPureza:98%Cor e Forma:SolidPeso molecular:1660.91PYX 1
CAS:PYX 1 is an effective orexigenic peptide.Fórmula:C70H105Cl2N19O16Pureza:98%Cor e Forma:SolidPeso molecular:1539.61Boc-Glu(OBzl)-OH
CAS:Boc-Glu(OBzl)-OH (Boc-Glu(OBzl)-OH) is an Glutamic acid derivative.Fórmula:C17H23NO6Pureza:98.11%Cor e Forma:SolidPeso molecular:337.37β-Secretase inhibitor-STA
CAS:<p>BACE-IN-1 is amyloid precursor protein beta-secretase inhibitor</p>Fórmula:C73H118N16O27Pureza:98%Cor e Forma:SolidPeso molecular:1651.81SP-346 nonapeptide
CAS:SP-346 nonapeptide is a pipecolic acid substituted nonapeptide.Fórmula:C48H77N13O14Pureza:98%Cor e Forma:SolidPeso molecular:1060.221SYSMEHFRWGKPS
<p>SYSMEHFRWGKPS is a 13-amino acid peptide.</p>Fórmula:C73H102N20O20SPureza:98%Cor e Forma:SolidPeso molecular:1611.81β-Amyloid (1-15)
CAS:β-Amyloid (1-15) (Amyloid β-Protein (1-15)) is a fragment of β-amyloid protein used in the study of Alzheimer's disease.Fórmula:C78H107N25O27Pureza:99.88%Cor e Forma:SolidPeso molecular:1826.84Egg Laying Hormone, aplysia
CAS:<p>ELH, a neuropeptide from Aplysia's bag cells, triggers egg laying, has 36 amino acids, Mr 4385, pI 9.7, and induces Na+ current in neurons.</p>Fórmula:C190H329N59O57SPureza:98%Cor e Forma:SolidPeso molecular:4384.2HPV16 E7 (86-93) (TFA)(160212-93-1,free)
HPV16 E7 (86-93) TFA is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide.Fórmula:C39H67F3N8O12SPureza:98%Cor e Forma:SolidPeso molecular:929.06SEB Domain 144-153 TFA(210229-94-0 free base)
SEB Domain 144-153 TFA blocks transcytosis of SEE, SEA, TSST-1. It's an Enterotoxin B fragment.Fórmula:C52H91F3N14O19Pureza:98%Cor e Forma:SolidPeso molecular:1273.35Lagatide
CAS:Lagatide is a synthetic heptapeptide that has antisecretory activity.Fórmula:C33H58N10O9Pureza:98%Cor e Forma:SolidPeso molecular:738.88CDK2
CAS:<p>CDK2, a eukaryotic S/T kinase, catalyzes ATP γ-phosphate transfer to serine/threonine in proteins.</p>Fórmula:C35H57N15O9Pureza:98%Cor e Forma:SolidPeso molecular:831.92Dentonin acetate
Dentonin acetate enhances osteogenesis and facilitates immature adherent cell survival.Fórmula:C109H164N30O44Pureza:96.91%Cor e Forma:SolidPeso molecular:2598.64ovalbumin (324-338) [Gallus gallus]/[Coturnix coturnix]
Ovalbumin is egg white's main protein (60-65%) used in research on protein structure, serpin function, proteomics, and immunology.Fórmula:C66H105N21O23Pureza:98%Cor e Forma:SolidPeso molecular:1560.67LKKTETQ acetate
LKKTETQ acetate is the active site in the protein thymosin β4 responsible for wound healing, actin binding and cell migration.Fórmula:C38H70N10O15Pureza:99.9%Cor e Forma:SolidPeso molecular:907.02SNAP-25 187-203
Amino acids 187-203 from SNAP-25's C-terminal helix can restore exocytosis in BoNT/E-affected cells at high doses.Fórmula:C71H125N27O26Pureza:98%Cor e Forma:SolidPeso molecular:1772.92S1b3inL1
CAS:S1b3inL1 is a macrocylcic peptide inhibitor of the SARS-CoV-2 spike protein. It binds with high affinity to a conserved site on the spike protein, effectively suppressing the infection of various SARS-CoV-2 variants. S1b3inL1 exhibits antiviral activity.Fórmula:C103H158N30O24SCor e Forma:SolidPeso molecular:2232.61EGF Receptor Substrate 2 Phospho-Tyr5
EGF Receptor Substrate 2 (Phospho-Tyr5) is a biologically active peptide derived from an autophosphorylation site (Tyr992) of EGFR.Fórmula:C54H82N13O24Pureza:98%Cor e Forma:SolidPeso molecular:1328.28Tos-Gly-Pro-Arg-ANBA-IPA
CAS:Tos-Gly-Pro-Arg-ANBA-IPA: a substrate for rapid hirudin assay.Fórmula:C30H41N9O8SPureza:98%Cor e Forma:SolidPeso molecular:687.77Neurotensin-related hexapeptide
CAS:Neurotensin hexapeptide in pigeon retinal cells may serve as a neuroactive agent.Fórmula:C36H58N8O9Pureza:98%Cor e Forma:SolidPeso molecular:746.89PR 39 (porcine) acetate
PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.Pureza:98%Cor e Forma:LiquidPeso molecular:N/ABQ-3020 TFA (143113-45-5 free base)
BQ-3020 (TFA) is a selective ETB agonist with a 0.2nm IC50, blocking [125I] ET-1 in the cerebellum and causing vasoconstriction.Fórmula:C98H141F3N20O27SPureza:98%Cor e Forma:SolidPeso molecular:2120.35Agouti-related Protein (AGRP) (25-82), human
AgRP is a brain-produced neuropeptide, made in hypothalamic neurons, stoking appetite; leptin blocks and ghrelin activates it.Fórmula:C279H468N80O90S1Pureza:98%Cor e Forma:SolidPeso molecular:6415.39Mast Cell Degranulating Peptide HR-2
CAS:Peptide from giant hornet Vespa orientalis that has biological effects similar to mast cell degranulating peptide from bee venom.Fórmula:C77H135N17O14Pureza:98%Cor e Forma:SolidPeso molecular:1523APTSTAT3-9R acetate
APTSTAT3-9R acetate is a selective peptide binding STAT3 with antiproliferative and antitumor activity.Fórmula:C225H334N80O53Pureza:98%Cor e Forma:SolidPeso molecular:5007.56Urocortin, rat TFA (171543-83-2 free base)
Urocortin, rat TFA is a neuropeptide and a potent endogenous CRFR agonist (Kis: 0.97 nM, 1.5 nM, and 13 nM for mouse CRF2β, rat CRF2α, and human CRF1).Fórmula:C208H339N62F3O66Pureza:98%Cor e Forma:SolidPeso molecular:4821.28S Tag Peptide
CAS:S Tag Peptide is a 15 amino acid peptide derived from RNase A.Fórmula:C73H117N23O25SPureza:98%Cor e Forma:SolidPeso molecular:1748.91Fibrinopeptide B, human TFA (36204-23-6 free base)
<p>FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment.</p>Fórmula:C68H94F3N19O27Pureza:98%Cor e Forma:SolidPeso molecular:1666.58Foxy-5 Ammonium Salt
Foxy-5 Ammonium Salt, a WNT5A mimetic, blocks epithelial cancer cell migration without β-catenin impact and curbs prostate cancer spread.Fórmula:C26H46N7O12S2Pureza:97.70%Cor e Forma:SolidPeso molecular:712.26Ac-IEVDIDVE (TFA)
Ac-IEVDIDVE TFA is a short peptide sequence.Fórmula:C44H69F3N8O20Pureza:98%Cor e Forma:SolidPeso molecular:1087.061,3-Dimethyl-3,4,5,6-tetrahydro-2(1H)-pyrimidinone
CAS:Fórmula:C6H12N2OPureza:≥ 98.0%Cor e Forma:Colourless to light yellow liquidPeso molecular:128.18Somatostatin 1-28
CAS:Somatostatin receptor agonist, derived from the post-translational cleavage of prosomatostatin.Fórmula:C137H207N41O39S3Pureza:98%Cor e Forma:SolidPeso molecular:3149Jingzhaotoxin XI
Jingzhaotoxin XI (JZTX-XI) is a potent inhibitor of sodium conductance, exhibiting an IC50 value of 124 nM, and notably retards the rapid inactivation of Na_v1.Fórmula:C158H234N44O47S7Pureza:98%Cor e Forma:SolidPeso molecular:3726.27C-Type Natriuretic Peptide (1-22) acetate(human)
CNP (1-22), human acetate, NPR-B agonist, inhibits cAMP synthesis, counters histamine and 5-HT effects.Fórmula:C97H162F3N27O32S3Pureza:95.95%Cor e Forma:SolidPeso molecular:2371.68Ornithine glutamate dipeptide
CAS:<p>Ornithine glutamate dipeptide is a amino acid.</p>Fórmula:C10H19N3O5Pureza:98%Cor e Forma:SolidPeso molecular:261.27CysHHC10 acetate
CysHHC10 acetate is antibacterial; MIC: E. coli 10.1mM, P. aeruginosa 20.2mM, S. aureus 2.5mM, S. epidermidis 1.3mM.Fórmula:C79H111N23O12SPureza:98.33%Cor e Forma:SolidPeso molecular:1606.94LSKL TFA
CAS:LSKL TFA (H-Leu-Ser-Lys-Leu-NH2 TFA) is a TGF-尾1 antagonist that inhibits TSP-1 binding to LAP and reduces renal interstitial fibrosis and liver fibrosis.Fórmula:C23H43F3N6O7Pureza:99.33%Cor e Forma:SolidPeso molecular:572.62RGD peptide (GRGDNP) (TFA) (114681-65-1 free base)
RGD peptide (GRGDNP) (TFA) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.Fórmula:C25H39F3N10O12Pureza:98%Cor e Forma:SolidPeso molecular:728.63TAT (48-57) TFA(253141-50-3,free)
TAT (48-57) (TFA) is a cellular permeability peptide derived from hiv-1 transcriptional activator (TAT) protein residue 48-57.Fórmula:C55H109N31O12·C2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:1510.67Boc-Gly-Gly-Phe-Gly-OH TFA(187794-49-6,free)
Boc-Gly-Gly-Phe-Gly-OH TFA is a self-assembly of N-protected and C-protected tetrapeptides and is a protease cleaved connector for antibody-drug binding (ADC).Fórmula:C22H29F3N4O9Pureza:98%Cor e Forma:SolidPeso molecular:550.48MmTx1 toxin
Micrurotoxin 1 (MmTx1 toxin) acts as an allosteric modulator of GABA A receptors, enhancing the receptor's sensitivity to its agonist [1].Fórmula:C295H455N95O97S10Pureza:98%Cor e Forma:SolidPeso molecular:7205Spinoxin
CAS:Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges.Fórmula:C147H236N48O46S9Pureza:98%Cor e Forma:SolidPeso molecular:3700.33Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated)
CAS:Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) is a hirugen-like peptide with greater thrombin affinity than Hirugen, exhibiting a dissociation constant (KFórmula:C64H88N10O26SPureza:98%Cor e Forma:SolidPeso molecular:1445.5type II collagen fragment
Type II collagen, a triple helix of α chains, forms a fibril meshwork crucial in arthritides, with slow turnover in cartilage.Fórmula:C65H102N18O21Pureza:98%Cor e Forma:SolidPeso molecular:1471.61TAT-SAMβA
TAT-SAMβA, an RNAENFDRF (SAMβA) peptide conjugated to the TAT 47–57 protein-derived cell-penetrating peptide, acts as a selective antagonist of the Mfn1-βIIPKCFórmula:C118H195N51O31Pureza:98%Cor e Forma:SolidPeso molecular:2824.13Z-Leu-Leu-Tyr-COCHO
CAS:<p>Z-Leu-Leu-Tyr-COCHO is a potent inhibitor of chymotrypsin-like activity, exhibiting a Ki value of 3.0 nM [1].</p>Fórmula:C30H39N3O7Pureza:98%Cor e Forma:SolidPeso molecular:553.65PKCα (C2-4) inhibitor peptide
PKCα (C2-4) inhibitor peptide is a specific antagonist to PKCα that impedes the α1A-adrenoreceptor agonist A-61603 [1] from inhibiting I_Kr.Fórmula:C47H74N14O17Pureza:98%Cor e Forma:SolidPeso molecular:1107.17REDV TFA
REDV TFA, the minimal active sequence of the CS5 site in the alternatively spliced type III connecting segment (IIICS) of fibronectin, mediates adhesion to theFórmula:C20H35N7O9·xC2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:517.53 (free acid)µ-Conotoxin GIIIB
CAS:μ-Conotoxin GIIIB, a 22-residue polypeptide derived from the venom of the piscivorous cone snail Conus geographus, serves as an inhibitor of the Na V 1.4Fórmula:C101H175N39O30S7Pureza:98%Cor e Forma:SolidPeso molecular:2640.17BMAP-28
CAS:BMAP-28, an antibiotic peptide, induces cell death by triggering the mitochondrial permeability transition pore and serves as a research tool in the study ofFórmula:C145H250N44O29Pureza:98%Cor e Forma:SolidPeso molecular:3073.81GRGDSPK acetate
CAS:GRGDSPK acetate shows inhibitory activity against integrin-fibronectin binding and can be used in research on integrins in bone formation and resorption.Fórmula:C30H53N11O13Pureza:97.9%Cor e Forma:SoildPeso molecular:775.81C-Reactive Protein (CRP) (77-82)
CAS:<p>CRP 77-82 is a fragment of CRP, a pentameric, plasma protein that marks inflammation and cardiovascular risk, rising with IL-6 from macrophages/T cells.</p>Fórmula:C23H40N6O10Pureza:98%Cor e Forma:SolidPeso molecular:560.61Myoregulin
Myoregulin (MLN peptide), a regulin family member, modulates muscle performance through intracellular calcium handling.Fórmula:C239H391N53O67S3Pureza:98%Cor e Forma:SolidPeso molecular:5175.17N-myristoyl-RKRTLRRL
CAS:<p>N-myristoyl-RKRTLRRL is a compound that impedes the binding of protein kinase C (PKC) substrates and inhibits calcium (Ca2+)- and phosphatidylserine (PS)-</p>Fórmula:C60H117N21O11Pureza:98%Cor e Forma:SolidPeso molecular:1308.71Tamapin TFA
<p>Tamapin TFA, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small conductance Ca(2+)-activated K</p>Fórmula:C146H238N44O41S6·xC2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:3458.11 (free base)Jingzhaotoxin-XII
<p>Jingzhaotoxin-XII (JzTx-XII) functions as a potent inhibitor of the Kv4.1 channel, exhibiting an inhibitory concentration (IC50) of 0.363 μM.</p>Fórmula:C161H227N41O44S7Pureza:98%Cor e Forma:SolidPeso molecular:3665.23PKCη pseudosubstrate inhibitor,myristoylated
CAS:<p>Myristoylated PKCη pseudosubstrate inhibitor is a cell-permeable compound utilized to investigate the mechanism of action of PKCη [1].</p>Fórmula:C101H185N41O23SPureza:98%Cor e Forma:SolidPeso molecular:2373.88Quinupristin (mesylate) (120138-50-3 free base)
Quinupristin: a streptogramin antibiotic combatting multidrug-resistant S. aureus and Enterococcus.Fórmula:C53H68N9O10S·CH3SO3Pureza:98%Cor e Forma:SolidPeso molecular:1118.3CEP dipeptide 1
CAS:CEP dipeptide 1 stimulates angiogenesis, playing a key role in age-related macular degeneration (AMD).Fórmula:C18H27N3O6Pureza:98%Cor e Forma:SolidPeso molecular:381.42p2Ca
CAS:p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.Fórmula:C47H66N8O12Pureza:98%Cor e Forma:SolidPeso molecular:935.07Octapeptide-2
CAS:<p>Octapeptide-2 is a bioactive peptide known for its hair growth-promoting effects and is reported to be used as a cosmetic ingredient [1].</p>Fórmula:C38H60N10O16SPureza:98%Cor e Forma:SolidPeso molecular:945.01Nuclear pore complex protein Nup98 315-360
<p>Nuclear pore complex protein Nup98 (315-360) is the 315-360 fragment part of the nuclear pore complex (NPC) protein.</p>Fórmula:C190H288N50O64SPureza:98%Cor e Forma:SolidPeso molecular:4328.68Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]
IGHM fragment [Homo sapiens]: Part of B-cell antigen recognition; 2 heavy, 2 light chains; contains antigen-binding site.Fórmula:C82H132N24O20Pureza:98%Cor e Forma:SolidPeso molecular:1774.07HIV-1 TAT 48-60
HIV-1 TAT (48-60) is a cell-penetrating peptide from HIV-1 Tat protein residues 48-60.Fórmula:C70H131N35O16Pureza:98%Cor e Forma:SolidPeso molecular:1719ɛPKC(85-92),Myristoylated
CAS:PKC(85-92)，Myristoylated is a myristic acid-conjugated, cell-permeable peptide activator of PKC that has been shown to increase nitric oxide (NO) release inFórmula:C53H80N10O15Pureza:98%Cor e Forma:SolidPeso molecular:1097.26LRRKtide TFA
LRRKtide, a peptide substrate for leucine-rich repeat kinase 2 (LRRK2)—an enzyme often mutated in Parkinson's disease patients—corresponds to amino acids 550-Fórmula:C83H147N31O22·XCF3COOHCor e Forma:SolidPeso molecular:1931.30Acetyl decapeptide-3
CAS:Acetyl decapeptide-3 is a peptide that can stimulate collagen and elastin to increase skin elasticity and increase cell growth and improve healing and repair.Fórmula:C68H95N19O17Pureza:98%Cor e Forma:SolidPeso molecular:1450.6Sdrnflrfamide
CAS:Sdrnflrfamide exhibits FMRFamide-like immunoreactivity isolated from the nervous system of the lobster Homarus americanus.Fórmula:C47H72N16O12Pureza:98%Cor e Forma:SolidPeso molecular:1053.17Difopein TFA (396834-58-5 free base)
Difopein (TFA) is a 14-3-3 protein inhibitor that induces apoptosis and boosts cisplatin efficacy.Fórmula:C275H425N76F3O91S6Pureza:98%Cor e Forma:SolidPeso molecular:6501.19Dusquetide aceate
<p>Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.</p>Fórmula:C27H51N9O7Pureza:97.33%Cor e Forma:SolidPeso molecular:613.75Spaglumic acid acetate
Spaglumic acid acetate (Isospaglumic acid acetate) is a neuropeptide found in millimolar concentrations in brain.Fórmula:C13H20N2O10Pureza:99.49%Cor e Forma:SolidPeso molecular:364.31TAT TFA (191936-91-1 free base)
<p>TAT TFA (YGRKKRRQRRR) is derived from human immunodeficiency virus (hiv-1) transcription reverse activator TAT, is a cell penetrating peptide.</p>Fórmula:C66H119N32F3O16Pureza:98%Cor e Forma:SolidPeso molecular:1673.85BDC2.5 mimotope 1040-51
CAS:BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.Fórmula:C60H99N17O13SPureza:98%Cor e Forma:SolidPeso molecular:1298.6Somatostatin-28 (1-12)
CAS:Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Fórmula:C49H81N17O19SPureza:98%Cor e Forma:SolidPeso molecular:1244.33Benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate
CAS:Fórmula:C18H28N6OP·PF6Pureza:≥ 97.5%Cor e Forma:White to off-white or slightly yellow crystalline powderPeso molecular:520.40Pep1-TGL
Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunitFórmula:C41H71N11O15SPureza:98%Cor e Forma:SolidPeso molecular:990.14Microcystin YR
CAS:Microcystin YR (Cyanoginosin YR) is a cyclic peptide and acts as an inhibitor of protein phosphatase 2A (PP2A).Fórmula:C52H72N10O13Cor e Forma:SolidPeso molecular:1045.19PD-1/PD-L1 inhibitory peptide C8
PD-1/PD-L1 inhibitory peptide C8 disrupts the PD-1/PD-L1 interaction, leading to the activation of CD8+ and CD4+ T cells and an increase in IFN-γ secretion. In mouse models, PD-1/PD-L1 inhibitory peptide C8 has demonstrated antitumor activity.Fórmula:C51H72N14O14S2Cor e Forma:SolidPeso molecular:1169.33Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.Fórmula:C85H127N25O27SPureza:98%Cor e Forma:SolidPeso molecular:1963.13RLLFT-NH2
CAS:TFLLR-NH2, reversed amino acid sequence control peptide, is a PAR1 selective agonist that significantly increases the nociceptive threshold.Fórmula:C31H53N9O6Pureza:98%Cor e Forma:SolidPeso molecular:647.81N,N''-Carbonyldiimidazole
CAS:Fórmula:C7H6N4OPureza:(Titration) ≥ 97.0%Cor e Forma:White, off-white or pale yellow powder or crystalsPeso molecular:162.15Neuropeptide Y (scrambled)
<p>NPY: a 36-amino acid neuropeptide, affects vasoconstriction, memory, appetite, and circadian rhythm via G-protein receptors in nervous systems.</p>Fórmula:C190H287N55O57Pureza:98%Cor e Forma:SolidPeso molecular:4253.76-CR110, SE [6-Carboxyrhodamine 110, succinimidyl ester]*Single isomer*
6-CR110, SE [6-Carboxyrhodamine 110, succinimidyl ester]*Single isomer* is a Fluorescein for peptide and oligonucleotide labeling.Fórmula:C25H18ClN3O7Pureza:98%Cor e Forma:SolidPeso molecular:523.92Z-AEVD-FMK
CAS:Z-AEVD-FMK (Z-Ala-Glu-Val-Asp-Fluoromethyl Ketone) is a degradable ADC linker and a caspase-10 inhibitor, reducing TNF-α/butyrate-induced cell apoptosis.Fórmula:C28H39FN4O10Cor e Forma:SolidPeso molecular:610.63Val-Lys(Boc)-PAB
CAS:Val-Lys(Boc)-PAB, an ADC linker, facilitates the synthesis of camptothecin peptide conjugates as antitumor agents and serves as a non-linear self-immolative linker to lessen the hydrophobicity of antibody-drug conjugates in cancer therapy.Fórmula:C23H38N4O5Cor e Forma:SolidPeso molecular:450.58WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Fórmula:C55H74N10O13SPureza:98%Cor e Forma:SolidPeso molecular:1115.3Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Fórmula:C52H83N17O15Pureza:98%Cor e Forma:SolidPeso molecular:1186.32P17 Peptide
CAS:P17 Peptide, a human TGF-β1 inhibitory peptide, effectively blocks the activity of woodchuck TGF-β1.Fórmula:C95H139N27O21Cor e Forma:SolidPeso molecular:1995.29Enterotoxin STp TFA
Enterotoxin STp TFA, a heat-stable enterotoxin, is utilized in vaccine research.Fórmula:C81H110N20O26S6·xC2HF3O2Cor e Forma:SolidPeso molecular:1972.25 (free acid)C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse
CAS:C-Type Natriuretic Peptide (1-53), from porcine, rat, and mouse sources, serves as an activator of particulate guanylate cyclase B (pGC-B), prominently found in endothelial cells, kidneys, and the heart. This peptide efficiently mediates a potent anti-fibrotic effect in human cardiac and renal fibroblasts through the production of the second messenger cGMP.Cor e Forma:SolidFmoc N-hydroxysuccinimide ester
CAS:Fórmula:C19H15NO5Pureza:≥ 98.0%Cor e Forma:White to off-white crystalline powderPeso molecular:337.34Super Fluor 555
<p>Super Fluor 555 dye attaches to proteins for bright, stable, sensitive detection of biological structures.</p>Pureza:98%Cor e Forma:SolidPeso molecular:N/AAc-VDQQD-pNA
CAS:Ac-VDQQD-pNA serves as a substrate for Caspase 2, which cleaves it to yield the yellow compound pNA (p-nitroaniline).Fórmula:C31H43N9O14Cor e Forma:SolidPeso molecular:765.73C14TKL-1 TFA
Endogenous human tachykinin-like peptide and potent agonist for NK1 receptors (EC50 = 1 nM).Fórmula:C63H98N20O13S2Pureza:98%Cor e Forma:SolidPeso molecular:1406.7gp96-II
<p>Gp96-II is a gp96-blocking peptide that antagonizes cytokine production induced by gp96-mediated LPS. This compound is useful for research into inflammatory diseases.</p>Fórmula:C200H353N59O53SCor e Forma:SolidPeso molecular:4464.37Imperatoxin A TFA
Imperatoxin A TFA, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, acts as an activator of Ca2+-release channels/ryanodine receptors (RyRs). It facilitates the influx of Ca2+ from the sarcoplasmic reticulum into the cell.Fórmula:C148H254N58O45S6·xC2HF3O2Cor e Forma:SolidPeso molecular:3758.35 (free base)Skeletal muscle-targeted peptide MSP
CAS:Skeletal muscle-targeted peptide MSP, a muscle-targeting peptide (MTP) composed of seven amino acids (ASSLNIA), selectively binds to various ligands in muscle tissues. This targeting capability makes it a useful tool in researching cardiac and skeletal muscle diseases.Fórmula:C28H50N8O11Cor e Forma:SolidPeso molecular:674.74S-palm P0(180-199) TFA
S-palm P0(180–199) (TFA) is a peptide that enhances MHC II-restricted responses. It is utilized to develop models of chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) and chronic experimental autoimmune neuritis (c-EAN). S-palm P0(180–199) (TFA) is also studied in the context of autoimmune-mediated neuritis.Fórmula:C112H191N33O29S2·xC2HF3O2Cor e Forma:SolidPeso molecular:2528.05 (free base)Vasopressin
CAS:Vasopressin: cyclic 9-peptide from hypothalamus, aids water reabsorption, blood pressure, and acts as neurotransmitter via G-protein receptors.Fórmula:C46H65N15O12S2Pureza:98%Cor e Forma:SolidPeso molecular:1084.24MHC class II antigen (45-57) [Homo sapiens]
MHC class II (45-57) peptide, sequence DLDKKETVWHLEE, MW 1868.07, in human antigen-presenting cells/lymphocytes.Fórmula:C73H112N18O25Pureza:98%Cor e Forma:SolidPeso molecular:1641.78Transdermal Peptide TFA (918629-48-8 free base)
TD 1 Peptide TFA: 11-amino acid, binds Na+/K+ ATPase beta-subunit, improves large molecule skin transmission.Fórmula:C42H65F3N14O18S2Pureza:98%Cor e Forma:SolidPeso molecular:1175.17Ac-AAVALLPAVLLALLAP-LEVD-CHO
CAS:Ac-AAVALLPAVLLALLAP-LEVD-CHO is a cell-permeable inhibitor of caspase-4 that exhibits antitumor activity [1].Fórmula:C96H164N20O25Pureza:98%Cor e Forma:SolidPeso molecular:1998.45Jingzhaotoxin-IX
<p>Jingzhaotoxin-IX is a C-terminally amidated peptide neurotoxin consisting of 35 amino acid residues.</p>Fórmula:C171H251N49O48S6Pureza:98%Cor e Forma:SolidPeso molecular:3953.51Ac-ESMD-CHO
CAS:<p>Ac-ESMD-CHO functions as an inhibitor of both caspase-3 and caspase-7, specifically obstructing the proteolytic cleavage of the caspase-3 precursor peptide (</p>Fórmula:C19H30N4O10SPureza:98%Cor e Forma:SolidPeso molecular:506.53
![[Des-octanoyl]-Ghrelin (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2241.webp&w=3840&q=75)
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![ovalbumin (324-338) [Gallus gallus]/[Coturnix coturnix]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2280.webp&w=3840&q=75)
![Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2260.webp&w=3840&q=75)
![MHC class II antigen (45-57) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2270.webp&w=3840&q=75)
