CAS 197922-42-2
:Teduglutide
Description:
Teduglutide is a synthetic analog of human glucagon-like peptide-2 (GLP-2), a hormone involved in the regulation of intestinal growth and function. It is primarily used in the treatment of short bowel syndrome, a condition that can arise after surgical removal of a significant portion of the intestine. Teduglutide promotes intestinal absorption of nutrients and fluids, thereby improving the quality of life for patients with this condition. The substance is administered via subcutaneous injection and has a relatively long half-life due to its resistance to enzymatic degradation. Its mechanism of action involves binding to the GLP-2 receptor, leading to enhanced intestinal mucosal growth, increased villus height, and improved nutrient absorption. Common side effects may include gastrointestinal symptoms, such as nausea and abdominal pain, as well as potential risks of neoplasia due to its growth-promoting effects. Overall, Teduglutide represents a significant advancement in the management of short bowel syndrome, offering patients improved nutritional status and reduced dependence on parenteral support.
Formula:C164H252N44O55S
Synonyms:- Alx 0600
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Found 8 products.
Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)
CAS:Controlled ProductApplications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)Formula:C164H244D8N44O55S•C2HF3O2•x(H2O)Color and Shape:NeatMolecular weight:3760.081140218Teduglutide
CAS:Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).Formula:C164H252N44O55SPurity:98.08%Color and Shape:White SolidMolecular weight:3752.08Teduglutide
CAS:Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITDFormula:C164H252N44O55SPurity:Min. 95%Molecular weight:3,752.16 g/molTeduglutide (GLP2 2G)
CAS:Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.Formula:C164H252N44O55SColor and Shape:PowderMolecular weight:3,749.8 g/molTeduglutide trifluoroacetate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C164H252N44O55SMolecular weight:3,752.08 g/mol






