CAS 197922-42-2

Teduglutide

Description:

Teduglutide is a synthetic analog of human glucagon-like peptide-2 (GLP-2), a hormone involved in the regulation of intestinal growth and function. It is primarily used in the treatment of short bowel syndrome, a condition that can arise after surgical removal of a significant portion of the intestine. Teduglutide promotes intestinal absorption of nutrients and fluids, thereby improving the quality of life for patients with this condition. The substance is administered via subcutaneous injection and has a relatively long half-life due to its resistance to enzymatic degradation. Its mechanism of action involves binding to the GLP-2 receptor, leading to enhanced intestinal mucosal growth, increased villus height, and improved nutrient absorption. Common side effects may include gastrointestinal symptoms, such as nausea and abdominal pain, as well as potential risks of neoplasia due to its growth-promoting effects. Overall, Teduglutide represents a significant advancement in the management of short bowel syndrome, offering patients improved nutritional status and reduced dependence on parenteral support.

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Synonyms:

• Alx 0600

ALX 0600

CAS: 197922-42-2

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purity: 98%

Color and Shape: Solid

Molecular weight: 3752.0825

Ref: IN-DA00ACKN

Teduglutide

CAS: 197922-42-2

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Molecular weight: 3752.13

Ref: 4Z-PT-312001

Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)

Controlled Product

CAS: 197922-42-2

Applications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)

Formula: C₁₆₄H₂₄₄D₈N₄₄O₅₅S•C₂HF₃O₂•x(H₂O)

Color and Shape: Neat

Molecular weight: 3760.081140218

Ref: TR-T013798

Teduglutide

CAS: 197922-42-2

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purity: 98.08%

Color and Shape: Solid

Molecular weight: 3752.08

Ref: TM-T35337

Teduglutide

CAS: 197922-42-2

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Purity: Min. 95%

Molecular weight: 3,752.16 g/mol

Ref: 3D-TED-3880-PI

Teduglutide (GLP2 2G)

CAS: 197922-42-2

Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Color and Shape: Powder

Molecular weight: 3,749.8 g/mol

Ref: 3D-CRB1000390

Teduglutide trifluoroacetate

CAS: 197922-42-2

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula: C₁₆₄H₂₅₂N₄₄O₅₅S

Molecular weight: 3,752.08 g/mol

Ref: 3D-PP50564