Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 164 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TT-OAD2
CAS:<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Formula:C50H49Cl4N3O6Purity:98%Color and Shape:SolidMolecular weight:929.75GLP-2(1-33)(human)
CAS:<p>GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.</p>Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19HAEGTFT
CAS:<p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Formula:C33H47N9O12Purity:98%Color and Shape:SolidMolecular weight:761.78GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68Apraglutide
CAS:<p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>Formula:C172H263N43O52Purity:98%Color and Shape:SolidMolecular weight:3765.25Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Color and Shape:SolidTaspoglutide
CAS:<p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>Formula:C152H232N40O45Purity:98%Color and Shape:SolidMolecular weight:3339.763LSN3160440
CAS:<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Formula:C27H27Cl2N3OColor and Shape:SolidMolecular weight:480.43Des His1, Glu8 Exendin-4
<p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>Formula:C179H277N47O59SPurity:99.92%Color and Shape:SolidMolecular weight:4063.46Secretin, porcine
CAS:<p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>Formula:C130H220N44O41·xC2H4O2Purity:98%Color and Shape:SolidMolecular weight:N/ATT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Formula:C50H47Cl2N3O6Purity:98%Color and Shape:SolidMolecular weight:856.83{Val1}-Exendin-3/4
<p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3241.7GLP-1R agonist 14
CAS:<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Formula:C45H42F2N10O5Color and Shape:SolidMolecular weight:840.88GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Color and Shape:SolidHAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Formula:C50H75N13O22Purity:97.47%Color and Shape:SolidMolecular weight:1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Color and Shape:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3055.49GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Purity:98.41%Color and Shape:Odour SolidBay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Formula:C189H290F3N45O61Purity:99.69%Color and Shape:SolidMolecular weight:4225.6482Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Formula:C192H289N47O61Purity:99.83%Color and Shape:SolidMolecular weight:4229.0957VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.033-Deoxyglucosone
CAS:<p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>Formula:C6H10O5Purity:95%Color and Shape:SolidMolecular weight:162.14Sorbinicate
CAS:<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Formula:C42H32N6O12Purity:98%Color and Shape:SolidMolecular weight:812.74Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formula:C148H224N40O45·xC2HF3O2Color and Shape:Solid(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Color and Shape:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Formula:C34H36ClFN6O4Color and Shape:SolidMolecular weight:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Formula:C32H33N5O4SeColor and Shape:SolidMolecular weight:630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Color and Shape:LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Purity:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Color and Shape:Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Formula:C191H299N45O59Molecular weight:4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Formula:C31H30Cl2F2N4O5Molecular weight:646.15613GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03GLP-1R agonist 4
CAS:<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Color and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Color and Shape:SolidGRPP (human)
CAS:<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Formula:C136H215N41O58SColor and Shape:SolidMolecular weight:3384.47Glucagon (1-29), bovine, human, porcine
CAS:<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Formula:C153H225N43O49SPurity:99.56% - 99.56%Color and Shape:SolidMolecular weight:3482.75GLP-1 receptor agonist 7
CAS:<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Formula:C31H30ClFN4O5Color and Shape:SolidMolecular weight:593.05GLP-1 receptor agonist 2
CAS:<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formula:C30H31ClFN5O4Color and Shape:SolidMolecular weight:580.05V-0219
CAS:<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Formula:C20H25F3N4O2Purity:99.91%Color and Shape:SoildMolecular weight:410.43GLP-1R modulator C16
CAS:<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Formula:C21H26ClFN2O3Purity:99.6% - >99.99%Color and Shape:SolidMolecular weight:408.89
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
