Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 193 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TT-OAD2
CAS:TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.
Formula:C50H49Cl4N3O6Purity:98%Color and Shape:SolidMolecular weight:929.75GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19HAEGTFT
CAS:HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.Formula:C33H47N9O12Purity:98%Color and Shape:SolidMolecular weight:761.78GLP-1(7-36), amide acetate
CAS:GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68Apraglutide
CAS:Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formula:C172H263N43O52Purity:98%Color and Shape:SolidMolecular weight:3765.25Dulaglutide
CAS:Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).Color and Shape:SolidTaspoglutide
CAS:Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetesFormula:C152H232N40O45Purity:98%Color and Shape:SolidMolecular weight:3339.763LSN3160440
CAS:LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.Formula:C27H27Cl2N3OColor and Shape:SolidMolecular weight:480.43Secretin, porcine
CAS:Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.Formula:C130H220N44O41·xC2H4O2Purity:98%Color and Shape:SolidMolecular weight:N/ATT-OAD2 free base
CAS:TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Formula:C50H47Cl2N3O6Purity:98%Color and Shape:SolidMolecular weight:856.83Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.Formula:C179H277N47O59SPurity:99.92%Color and Shape:SolidMolecular weight:4063.46{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3241.7GLP-1R agonist 14
CAS:GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Formula:C45H42F2N10O5Color and Shape:SolidMolecular weight:840.88GIP/GLP-1 dual receptor agonist-1
CAS:Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.Color and Shape:SolidMaridebart
CAS:Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Color and Shape:LiquidGLP-1R agonist 29
GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.Color and Shape:Odour SolidExendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3055.49GLP-1(7-37)
CAS:GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67HAEGTFTSDVS acetate
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.Formula:C50H75N13O22Purity:97.47%Color and Shape:SolidMolecular weight:1210.2Bay 55-9837
CAS:Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Purity:98.41%Color and Shape:Odour SolidVU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03Semaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormula:C189H290F3N45O61Purity:99.69% - 99.94%Color and Shape:SolidMolecular weight:4225.6482Survodutide
CAS:Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.Formula:C192H289N47O61Purity:99.83%Color and Shape:SolidMolecular weight:4229.0957Albiglutide fragment TFA
Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as aFormula:C148H224N40O45·xC2HF3O2Color and Shape:Solid3-Deoxyglucosone
CAS:3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormula:C6H10O5Purity:95%Color and Shape:SolidMolecular weight:162.14(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89Ribupatide
CAS:Ribupatide is a dual agonist of gastric inhibitory polypeptide (GIP) and glucagon-like peptide 1 (GLP-1) receptors and can be utilized in antidiabetic research.Color and Shape:SolidOxyntomodulin
CAS:GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86GLP-1 receptor agonist 8
CAS:GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Formula:C34H36ClFN6O4Color and Shape:SolidMolecular weight:647.14[Des-His1,Glu9]-Glucagon amide
CAS:Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.68GLP-1R agonist 27
GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).Formula:C32H33N5O4SeColor and Shape:SolidMolecular weight:630.6Vensemaglutide
CAS:Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Formula:C214H337N49O67Molecular weight:4668.25(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GLP-1R agonist 15
CAS:GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98GLP-1R agonist 26
CAS:Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formula:C32H29FN6O4SColor and Shape:SolidMolecular weight:612.67Liraglutide acetate
CAS:Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formula:C172H265N43O51·xC2H4O2Color and Shape:SolidMolecular weight:3751.20 (free base)Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5PHI-27 (porcine)
CAS:PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formula:C136H216N36O40Color and Shape:SolidMolecular weight:2995.39GLP-1R agonist 16
CAS:Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsColor and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15Dapiglutide
CAS:Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Color and Shape:SolidGRPP (human)
CAS:GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formula:C136H215N41O58SColor and Shape:SolidMolecular weight:3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formula:C142H215F3N36O45Color and Shape:SolidMolecular weight:3203.43DD202-114
CAS:DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formula:C33H35FN4O5Color and Shape:SolidMolecular weight:586.65Utreglutide
CAS:Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formula:C150H240F3ClN44O44Color and Shape:SolidMolecular weight:3456.22
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
