
Organic Halides
In this category, you can find organic molecules containing one or more halogen atoms in their structure. These organic halides include brominated, iodinated, chlorinated, and cyclic halide compounds. Organic halides are widely used in organic synthesis, pharmaceuticals, agrochemicals, and materials science due to their reactivity and ability to undergo a variety of chemical transformations. At CymitQuimica, we offer a comprehensive selection of high-quality organic halides to support your research and industrial applications, ensuring reliable and effective performance in your synthetic and analytical projects.
Subcategories of "Organic Halides"
Found 20442 products of "Organic Halides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol5-Chlorouracil
CAS:5-Chlorouracil is a drug that is used to treat cancer. It has been shown to have biological properties, and its mechanism of action is not yet fully understood. 5-Chlorouracil can be synthesized in the laboratory by reacting sodium hydroxide with 5-chloro-2,4(1H,3H)-pyrimidinedione. In wastewater treatment plants, it reacts with organic matter in the water to form nontoxic products, such as carbon dioxide and urea. The reaction solution contains 5-chlorouracil, which undergoes tautomerization spontaneously or through the addition of base. This reaction is reversible, and both the erythro and threo forms are present in solution at equilibrium. The biological properties of 5-chlorouracil have been investigated using sublethal doses in experimental animals. In one study, 5-chlorouracil was found to inhibit xanthine oxidase activity in rats significantly moreFormula:C4H3ClN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:146.53 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molCRAMP (mouse) trifluoroacetate salt
CAS:Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molH-Val-AMC trifluoroacetate salt
CAS:Please enquire for more information about H-Val-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H18N2O3Purity:Min. 95%Molecular weight:274.32 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.Formula:C7H4Cl3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:256.47 g/mol4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid
CAS:4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.Formula:C9H5F3N2O2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:230.14 g/molH-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Triphenylsulfonium chloride
CAS:Triphenylsulfonium chloride is a cross-linking agent that is used in the textile industry as a reactive dye and in plant physiology. It reacts with hydroxyl groups to form sulfonic acid esters. Triphenylsulfonium chloride also reacts with sodium salts, which yield an acid, and it has been used as a molecule for testing reactions involving radiation. This chemical can be activated by light or heat, forming a reactive cationic polymerization that is used in wastewater treatment.Formula:C18H15ClSPurity:Min. 95%Color and Shape:White PowderMolecular weight:298.83 g/molMca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C51H65N13O15Purity:Min. 95%Molecular weight:1,100.14 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled ProductPlease enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/molCinnamoyl chloride
CAS:Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.Formula:C9H7ClOPurity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:166.6 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C47H74N10O14SPurity:Min. 95%Molecular weight:1,035.22 g/molChloroac-DL-Phe-OH
CAS:Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.Formula:C11H12ClNO3Purity:Min. 95%Molecular weight:241.67 g/mol(2-Chloropyridin-4-yl)methanamine
CAS:2-Chloropyridin-4-yl)methanamine is a hydrogenated molecule that has been shown to inhibit the activity of certain cancer cells. It inhibits the expression of the enzyme molecules involved in the synthesis of DNA and RNA. 2-Chloropyridin-4-yl)methanamine also inhibits the hydrolysis of hydrogen chloride (HCl) to produce hydrogen (H2). This drug is used as an inhibitor for medicines that require acidic pH for absorption, such as HCl.Formula:C6H7ClN2Purity:Min. 95%Molecular weight:142.59 g/mol6-Fluoro-3,4-Pyridinediamine
CAS:Please enquire for more information about 6-Fluoro-3,4-Pyridinediamine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C5H6FN3Purity:Min. 95%Molecular weight:127.12 g/mol
