Organic Halides

<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>3-Bromophenol is an organic compound that is a bromophenol. It is used as a fluorometric probe in wastewater treatment and as a tracer for metabolic pathways in the proximal tubules of the kidney. 3-Bromophenol has a molecular weight of 184.16 g/mol and has been shown to be metabolized by bacteria into 2,4-dihydroxyphenylacetic acid (2,4-DPA). 3-Bromophenol can also be synthesized from 2,4-dihydroxyphenylacetic acid using sodium hydroxide solution and carbon source in a synthetic process. This synthetic process can be carried out at room temperature and atmospheric pressure.</p>

<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 2-bromo-5-nitrobenzoate is a potent inhibitor of aspartyl proteases, which are enzymes that are involved in the breakdown of fibrinogen. It has been shown to inhibit the growth of Staphylococcus aureus and other bacteria. Methyl 2-bromo-5-nitrobenzoate is also a potent inhibitor of lactamase, an enzyme that catalyzes the hydrolysis of lactams. This compound has been shown to have biological properties such as antioxidant and anticancer activity. A heterocycle with two nitro groups on the methylene bridge, it is reactive.</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[(4-Chlorophenyl)phenylmethyl]-1-piperazineethanol dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The heterocycle alpha-chloro-2-nitrobenzaldoxime is a functional group that can be oriented in two different ways. The diversity of the product arises from the fact that it is possible to create new functional groups by substitution on the benzene ring and on the nitrogen. Heterocyclization of alpha-chloro-2-nitrobenzaldoxime can be achieved by using other heterocycles such as isoxazoles, which are readily available in large quantities, as building blocks. This reaction can be catalyzed by reductive means with sodium borohydride and methanol.</p>

<p>Please enquire for more information about Zinc 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-hexadecafluoro-29H,31H-phthalocyanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>

<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>

<p>Chloromethyl isopropyl carbonate (CIC) is a prodrug that is converted to disoproxil in the body. It has significant cytotoxicity and antiviral activity against HIV and other viruses, but has not been used clinically due to its chemical instability. CIC can be administered orally as a prodrug, with the active form of CIC being tenofovir disoproxil. Tenofovir disoproxil is metabolized by proximal tubules and has shown efficacy for treating hepatitis B and C. Tenofovir has also been shown to decrease the incidence of renal disease in HIV patients.</p>

<p>Di-tert-butyldichlorosilane is a silicon compound that has been used to silylate amines and primary alcohols. It is a sterically hindered molecule with two chloro groups at the same position on one of the silicon atoms, which prevents or limits steric interactions with other molecules. Covid-19 Pandemic is the name given to a new strain of influenza virus that was discovered in 2009. The new strain contains some genetic material from bird flu, which makes it resistant to oseltamivir and zanamivir, drugs commonly used to fight against influenza infection.</p>

<p>2,3,5-Trichlorobenzaldehyde is a chemical compound that has been shown to have anticancer and apoptotic effects. It inhibits the growth of bacteria by chelating iron ions and inhibiting bacterial dna synthesis. 2,3,5-Trichlorobenzaldehyde has also been shown to inhibit the growth of cancer cells in culture in an experimental study. This chemical has been used as a substrate for nmr spectroscopy to study its functional groups and radical scavenging activities. 2,3,5-Trichlorobenzaldehyde can be synthesized from phenacyl chloride and benzaldehyde in the presence of hydrogen chloride gas. The carbonyl group in 2,3,5-trichlorobenzaldehyde may cause metabolic disorders such as diabetes mellitus or hyperglycemia.</p>

<p>Please enquire for more information about (3R,5S)-5-(Hydroxymethyl)pyrrolidin-3-ol hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 8-Fluoro-6-methoxy moxifloxacin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(2-Bromoethoxy)tetrahydro-2H-pyran is a synthetic molecule that has been shown to act as an estrogen receptor modulator, which has the potential to be used for the treatment of hormone-sensitive diseases such as breast cancer. This compound is chemically very similar to other compounds that have been shown to be effective in treating breast cancer. 2-(2-Bromoethoxy)tetrahydro-2H-pyran has a cavity and 6 hydroxyl groups that can form hydrogen bonds with water molecules, leading to its gelling properties. In addition, this compound is thermoreversible and can reversibly gel when heated or cooled. The gelation property of 2-(2-Bromoethoxy)tetrahydro-2H-pyran makes it a promising candidate for use in vaginal tablets, which could potentially lead to treatments for vaginal dryness and atrophy.</p>

<p>Undecafluorohexanoic acid is a perfluoroalkyl carboxylic acid that has been shown to disrupt steroidogenesis in vitro. It may be able to inhibit the transport of cholesterol, fats, and other lipids in cells, which causes disruption in steroidogenesis. This compound also has anti-cancer properties due to its ability to induce apoptosis and arrest cancer cell proliferation. Undecafluorohexanoic acid may also have developmental effects on animals because it can bind to estrogen receptors and disrupt the normal process of estrogen-mediated signaling pathways.</p>

<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>

<p>Acetylcholine perchlorate is a pharmacological agent that is used to induce acetylcholine release by the brain. It can be used to study cholinergic mechanisms in the brain and bowel disease. Acetylcholine perchlorate has been shown to have physiological effects, such as increasing heart rate and blood pressure, which may be due to its ability to activate nicotinic acetylcholine receptors. Acetylcholine perchlorate has also been shown to cause chemiluminescence reactions that are similar to those seen in biological studies of acetylcholine receptors.</p>

<p>12-Fluorododecan-1-ol is a volatile chemical compound that is found in the exoskeleton of termites. It has been shown to be a major component of the termiticide, FluoroCitrate. 12-fluorododecan-1-ol can be used to control the growth of insect populations by interfering with their ability to synthesize fatty acids and alcohols. It also has an effect on protein synthesis and inhibits the activity of citrate synthase, which is an enzyme involved in glycolate metabolism. This compound is also toxic to some species of insects such as Rhinotermitidae. 12-fluorododecan-1-ol can be used as a marker for Reticulitermes flavipes (a type of wood eating cockroach) and it can be used to distinguish between different species or strains of termites.</p>

<p>Indium (III) chloride is a reactive metal with a high oxidation state that has been shown to have significant cytotoxic effects in vitro. It is also genotoxic, which may be due to the generation of hydroxyl radicals and other reactive oxygen species. Indium (III) chloride has been used for the treatment of various infectious diseases, including HIV, Epstein-Barr virus, herpes simplex virus type 1, and influenza A virus. The toxicity of this metal is dependent on the concentration and duration of exposure. Indium (III) chloride is metabolized by plasma mass spectrometry as a substrate molecule for cytochrome P450 enzymes. This reaction results in the formation of an active metabolite that can bind to DNA and affect mitochondrial membrane potential. Indium (III) chloride has also been used as a contrast agent in fluorescein angiography or particle imaging techniques to visualize the presence of biological materials such as tissue necrosis or inflammation.</p>

<p>Please enquire for more information about 2-Chloro-3,5-bis(trifluoromethyl)pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>COX1/2 inhibitor; nonsteroidal anti-inflammatory drug</p>

<p>Please enquire for more information about N-(3-Aminopropyl)-2,2,3,3,4,4,5,5,6,6,7,7,8,8,8-pentadecafluorooctanamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,6-Dichloro trimellitic anhydride is a reactive compound that is used in the synthesis of fluorescent probes. It is also used as a reagent to introduce chlorine substituents onto organic molecules. Fluorescence measurements can be used to determine the purity of 3,6-dichloro trimellitic anhydride. This compound reacts with nucleic acids, causing them to fluoresce and making them detectable by spectroscopy. 3,6-Dichloro trimellitic anhydride has been used in research involving the study of nucleic acids and their role in DNA replication and repair.</p>

<p>Phenyl-magnesium bromide solution is a chemical compound that can be used as a pesticide. It has been shown to have carcinoid syndrome-inducing properties in animal studies. Phenyl-magnesium bromide solution has also been found to have biological properties that are beneficial for bowel disease, organometallic reactivity, and congestive heart failure. This chemical compound reacts with ester hydrochloride in the presence of an organic base to form a reactive intermediate that undergoes transfer reactions with other organic compounds. Phenyl-magnesium bromide solution is reactive and can cause metabolic disorders such as palladium-catalyzed coupling.</p>

<p>3'-O-Benzyl-2'-Deoxy-5-Trifluoromethyluridine (BDBMU) is a pyrimidine derivative that can be used as an antiviral drug. It inhibits the synthesis of DNA and RNA by inhibiting viral polymerase. BDBMU is a prodrug of uracil, which is converted to the active compound in tissues. The benzoylation reaction produces a fluorine atom at C5, which increases its potency. This drug has been shown to have minimal toxicity in tumor cells and has been used for the treatment of leukemia and other cancers.</p>

<p>Trityl chloride resin is a chemical compound that is used as a model system for the study of trifluoroacetic acid and its reactions. Trityl chloride resin is insoluble in water and has been used as a reaction solution for transfer reactions. It has been shown to be an effective ligand for many types of receptors, with binding constants ranging from 10 M-1 to 10 M-10. Trityl chloride resin can also be chiral, which means that it may exist in two forms that are mirror images of each other. The physiological effects of this compound are not well understood, but it has been shown to have an effect on coordination geometry.</p>

<p>Please enquire for more information about 10-Methyl-9-(phenoxycarbonyl)acridinium fluorosulfonate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Fluorohistidine is an organic compound with the formula CHFNO. It is a fluorinated derivative of histidine, and a precursor to histamine. 5-Fluorohistidine has been shown to be a potent thyrotropin-releasing hormone (TRH) analog, and is used in the synthesis of histamine. This compound has also been used as a tool for investigating the mechanism of TRH action by studying its stereoselective binding to protrusions from rat brain capillary endothelial cells. 5-Fluorohistidine has also been used as a microbial probe for detecting microbial protrusions from bacterial cells.</p>

<p>Please enquire for more information about Desmethylene paroxetine hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 2,5-dibromobenzoate is a cross-coupling reagent that is used to stabilize proteins. It is a hydrophobic compound that binds to the surface of proteins and prevents denaturation. Methyl 2,5-dibromobenzoate has been shown to be an effective binder for protein stabilization in a model system, where it was found to increase the reaction rate of Suzuki coupling reactions. This reagent can be used as a substitute for fluoroaromatic solvents in cross-coupling reactions.</p>

<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride is a chemical compound that is used as an intermediate in the synthesis of pharmaceuticals. It has been shown to be effective against 5-HT2C receptors and is used in the treatment of obesity. The mechanism of action for 4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride is not yet known but it may involve cleavage of amide bonds or stereoisomerism. 4-tert-Butyl-2,6-dimethylphenylsulfur Trifluoride has been synthesized by reacting hydrogen fluoride with sulfur trifluoride in the presence of a base.</p>

<p>Please enquire for more information about 6-(Bromomethyl)-1,1,4,4-tetramethyl-1,2,3,4-tetrahydronaphthalene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Chloroazetidine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,3-Dichloropropionitrile is a synthetic chemical that is used for the chlorination of calcium carbonate. It is also used in the production of ester hydrochloride and acrylonitrile. The reaction vessel contains calcium carbonate and malonic acid, which are heated with hydrochloric acid. 2,3-Dichloropropionitrile is added to the reaction products to produce ester hydrochloride and acrylonitrile. The product can be isolated by adding hydrogen chloride to the reaction mixture.</p>

<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>

<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2,6-Difluoro-4-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>