Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
OPA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OPA3 antibody, catalog no. 70R-9898
Purity:Min. 95%ATXN7L1 antibody
ATXN7L1 antibody was raised using the middle region of ATXN7L1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED
Fibrinogen antibody
The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.
Tetraspanin 12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN12 antibody, catalog no. 70R-7188
Purity:Min. 95%Enpatoran
CAS:Enpatoran is a peptide that is used as a research tool. It has been shown to activate an antibody and can be used for the inhibition of ion channels. Enpatoran also inhibits the activity of receptor-ligand interactions. It is a high purity, ion channels inhibitor, with CAS No. 2101938-42-3 and a molecular weight of 5,847 Da. Enpatoran binds to the ligand binding site on receptors and prevents the interaction between receptor and its ligands. This results in pharmacological effects on cells that are dependent on these interactions, such as cell proliferation or apoptosis.
Formula:C16H15F3N4Purity:Min. 95%Molecular weight:320.31 g/molRef: 3D-BJD93842
Discontinued productOSGEP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OSGEP antibody, catalog no. 70R-3838
Purity:Min. 95%MAX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAX antibody, catalog no. 70R-8413
Purity:Min. 95%ITGBL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ITGBL1 antibody, catalog no. 70R-1700
Purity:Min. 95%1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde
CAS:1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde is a ligand that is used as a research tool for studying protein interactions and receptor activation. It can be used to study ion channels, cell biology, and pharmacology. 1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde has been shown to inhibit the binding of an antibody to its antigen in an ELISA assay. This inhibitor is also a high purity reagent with CAS number 956716-93-1.Formula:C15H12N2O3SPurity:Min. 95%Molecular weight:300.3 g/molRef: 3D-GNB71693
Discontinued productNANP antibody
The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein (CSP) found on the surface of Plasmodium falciparum, the parasite responsible for malaria. This antibody has been shown to inhibit the invasion of red blood cells by the parasite and disrupt its life cycle. It binds to CSP and prevents it from interacting with host cell receptors, thereby preventing infection. The NANP antibody also has potential therapeutic applications in the treatment of other diseases, as it has been found to bind to other proteins such as collagen and tyrosine kinase-like growth factor-2. Its unique properties make it a valuable tool in life sciences research and drug development.
Pyruvate Kinase antibody
The Pyruvate Kinase antibody is a highly specialized monoclonal antibody that targets the pyruvate kinase enzyme. This antibody has been extensively studied in the field of Life Sciences and has shown significant potential for use in various applications. It exhibits cytotoxic activity against cancer cells, making it a promising candidate for targeted therapies. Additionally, this antibody has been found to interact with fibronectin, collagen, and other glycoproteins, indicating its potential role in cell adhesion and migration processes. Furthermore, studies have demonstrated that the Pyruvate Kinase antibody can modulate the production of interleukin-6 and activate the p38 MAPK pathway. With its unique properties and versatility, this antibody holds great promise for further research and development in the fields of oncology, immunology, and drug discovery.
TNFSF9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF9 antibody, catalog no. 70R-10317
Purity:Min. 95%PCMT1 antibody
PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD
EIF5A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF5A2 antibody, catalog no. 70R-3877
Purity:Min. 95%Androgen Receptor antibody
The Androgen Receptor antibody is a neutralizing monoclonal antibody that targets the androgen receptor, a protein involved in the regulation of male sexual development and function. This antibody has been shown to inhibit the activity of the androgen receptor, leading to decreased growth factor signaling and reduced expression of genes regulated by androgens.
Purity:Min. 95%COX4 antibody
The COX4 antibody is a highly specialized antibody that targets the COX4 protein. This protein plays a crucial role in various biological processes, including energy production and cellular respiration. The COX4 antibody is widely used in life sciences research to study the function and regulation of this important protein.
SCF protein
Region of SCF protein corresponding to amino acids MQEICRNPVT DNVKDITKLV ANLPNDYMIT LNYVAGMDVL PSHCWLRDMV THLSVSLTTL LDKFSNISEG LSNYSIIDKL GKIVDDLVAC MEENAPKNVK ESLKKPETRN FTPEEFFSIF NRSIDAFKDF MVASDTSDCV LSSTLGPEKD SRVSVTKPFM LPPVA.
Purity:Min. 95%Phenelzine-d4 sulfate
CAS:Controlled ProductPlease enquire for more information about Phenelzine-d4 sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O4SPurity:Min. 95%Molecular weight:238.3 g/molRef: 3D-WDC60503
Discontinued productTaccalonolide A
CAS:Taccalonolide A is a novel compound that has been shown to have clonogenic and radioprotective properties in vitro. Taccalonolide A has been shown to inhibit the proliferation of tumor cells and induce apoptosis, with an IC50 of 3.5 μM in a human breast cancer cell line. Taccalonolide A also inhibits the inflammatory response in an animal model of colitis. This activity may be due to its ability to inhibit NF-κB and STAT3 signaling pathways, which are involved in the regulation of inflammation. The two main chemical structures found in Taccalonolide A are taxanes and plantagines, which are used as anti-tumor drugs.
Formula:C36H46O14Purity:Min. 95%Molecular weight:702.75 g/molRef: 3D-IEA88568
Discontinued productRbm3 antibody
Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen
Purity:Min. 95%EIF4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4B antibody, catalog no. 70R-4927
Purity:Min. 95%ZNF21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF21 antibody, catalog no. 70R-7993
Purity:Min. 95%Antiproliferative Factor Sialoglycopeptide
Antiproliferative factor Sialoglycopeptide is a research tool that has been shown to activate the immune system. It has been used as a vaccine carrier and in immunotherapy. Antiproliferative factor Sialoglycopeptide binds to the C-type lectin receptor on erythrocytes, triggering an antibody response. This protein also interacts with ion channels, such as Ca2+ channels, and inhibits protein synthesis by inhibiting the tyrosine kinase activity of protein kinase A (PKA). Antiproliferative factor Sialoglycopeptide is a peptide that is active against many types of cancer cells and has been shown to inhibit tumor growth in mice. The CAS number for Antiproliferative Factor Sialoglycopeptide is 12074-48-2.
Formula:C63H107N11O29Purity:Min. 95%Molecular weight:1,482.6 g/molTSSK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSSK2 antibody, catalog no. 70R-2083
Purity:Min. 95%PCBP2 antibody
The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.
RWDD2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD2A antibody, catalog no. 70R-3777
Purity:Min. 95%ALG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALG2 antibody, catalog no. 70R-2876
Purity:Min. 95%ZNF276 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF276 antibody, catalog no. 70R-8223
Purity:Min. 95%CACNA2D4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA2D4 antibody, catalog no. 70R-9900
Purity:Min. 95%GAS2L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAS2L1 antibody, catalog no. 70R-5535
Purity:Min. 95%Carbonyl Reductase 1 antibody
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
SFTPD antibody
The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.
PRUNE antibody
The PRUNE antibody is a monoclonal antibody that specifically targets the cysteine-rich protein known as PRUNE. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. PRUNE is a multifunctional protein that acts as a growth factor and glycoprotein, playing a crucial role in cellular processes.
WDR23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR23 antibody, catalog no. 70R-3939
Purity:Min. 95%TAK 285
CAS:Inhibitor of HER2/EGFR receptor
Formula:C26H25ClF3N5O3Purity:Min. 95%Molecular weight:547.96 g/molSNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-4878
Purity:Min. 95%MPP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPP7 antibody, catalog no. 70R-2195
AML1 antibody
The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.
Mouse Macrophage antibody (FITC)
Mouse macrophage antibody (FITC) was raised in rabbit using mouse macrophages as the immunogen.MUS81 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MUS81 antibody, catalog no. 70R-10314
Purity:Min. 95%KIF9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF9 antibody, catalog no. 70R-5603
Purity:Min. 95%SKF-97541
CAS:SKF-97541 is a low potency antipsychotic drug that has been found to have agonist binding sites on the dopamine receptor. SKF-97541 has been shown to inhibit locomotor activity in rats and cell specific effects in mice. This drug also has synergistic effects with other drugs such as gamma-aminobutyric acid and fatty acids that are used for treatment of schizophrenia. SKF-97541 may be used as an experimental model for schizophrenia.
Formula:C4H12NO2PPurity:Min. 95%Molecular weight:137.12 g/molRef: 3D-CFA72935
Discontinued productBRF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRF1 antibody, catalog no. 20R-1153
Purity:Min. 95%RAE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4676
Purity:Min. 95%ZNF699 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF699 antibody, catalog no. 70R-9018
Purity:Min. 95%MFRP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6525
Purity:Min. 95%AGTR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AGTR2 antibody, catalog no. 70R-9956Purity:Min. 95%SH3BGRL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BGRL antibody, catalog no. 70R-3848
Purity:Min. 95%PDIA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA4 antibody, catalog no. 70R-7388
Purity:Min. 95%FL 411
CAS:FL 411 is a potent inhibitor of bromodomain, a protein that plays an important role in the regulation of gene expression. FL 411 has been shown to inhibit the growth of cancer cells and reduce the inflammatory response in patients with inflammatory bowel disease. It also inhibits viral replication by interacting with viral bromodomains. In addition, FL 411 is effective against cancer cells that have become resistant to conventional chemotherapy treatments. This drug has been shown to suppress tumor growth and proliferation by blocking the activation of protein kinase A (PKA) and subsequent phosphorylation of downstream targets such as growth factor-dependent protein kinases or amp-activated protein kinase (AMPK). It also reduces oxidative stress and inflammation by inhibiting reactive oxygen species production.
Formula:C18H19N3O2SPurity:Min. 95%Molecular weight:341.43 g/molRef: 3D-TJD94488
Discontinued productIgG Isotype Control antibody (PE)
Syrian Hamster monoclonal IgG Isotype Control antibody (PE)Purity:Min. 95%Complement C2 antibody
Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
Presenilin 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264
Purity:Min. 95%AQP1 antibody
The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.
HSV2 gC antibody
HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.
Donkey anti Mouse IgG (H + L) (FITC)
Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&L) as the immunogen.
Purity:Min. 95%ANKRD47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD47 antibody, catalog no. 70R-4426
Purity:Min. 95%CAPN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CAPN1 antibody, catalog no. 70R-10204
Purity:Min. 95%RAMP2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it has strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
N-Octadecyl-N'-propylsulfamide
CAS:Controlled ProductN-Octadecyl-N'-propylsulfamide (NDPS) is a pharmacological agent that acts as an anorectic, suppressant, and visceral stimulant. It has been shown to suppress appetite by activating the endocannabinoid system. NDPS inhibits the release of ghrelin, which stimulates appetite, and increases the release of leptin, which suppresses appetite. NDPS also interacts with other neurotransmitters such as dopamine and serotonin to inhibit food intake. This drug has been shown to have no effect on energy expenditure or body temperature in vivo studies in rats. NDPS binds to three types of cannabinoid receptors: CB1, CB2, and GPR55. The spectrum of action for NDPS is not limited to the central nervous system but extends to peripheral tissues as well. Vivo studies show that it is a potent activator of unsaturated alkyl chains in tissue culture cells. It has been shown to interact with several proteins including PPARγ
Formula:C21H46N2O2SPurity:Min. 95%Molecular weight:390.7 g/molRef: 3D-AMB89174
Discontinued productT2AA hydrochloride
CAS:T2AA hydrochloride is a molecule that inhibits the activity of the p21 protein. This protein is involved in cell cycle regulation, and its inhibition could be beneficial for cancer treatment. T2AA hydrochloride is non-classical in structure and has been shown to inhibit prostate cancer cells by binding to their nuclear DNA. It also inhibits the secretion of phospholipase A2, which may be an important mechanism for its antitumor effects. T2AA hydrochloride binds to the receptor site on human secretory phospholipase A2, thereby inhibiting its activity. T2AA hydrochloride has been shown to inhibit viral replication through its interaction with Rna polymerase, which may lead to new treatments for some types of cancer.
Formula:C15H15I2NO3·HClPurity:Min. 95%Molecular weight:547.55 g/molRef: 3D-FFC78227
Discontinued productMANEA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MANEA antibody, catalog no. 70R-7439
Purity:Min. 95%RAD54B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54B antibody, catalog no. 70R-5652
Purity:Min. 95%PI15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PI15 antibody, catalog no. 70R-10223
Purity:Min. 95%WNT11 antibody
The WNT11 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. This antibody specifically targets the amino group and acts as a growth factor, promoting cellular development and function.
D-Glucaro-d-Lactam
CAS:An inhibitor of β-Glucuronidase
Formula:C6H9NO6Purity:Min. 95%Molecular weight:191.14 g/mol
![1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FGNB71693.webp&w=3840&q=75)
