Biochemicals and Reagents

Mouse monoclonal V beta 13.1 TCR antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem184b antibody, catalog no. 70R-8663

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF2 antibody, catalog no. 70R-5703

1-552 amino acids: MGSSHHHHHH SSGLVPRGSH MDNMSITNTP TSNDACLSIV HSLMCHRQGG ESETFAKRAI ESLVKKLKEK KDELDSLITA ITTNGAHPSK CVTIQRTLDG RLQVAGRKGF PHVIYARLWR WPDLHKNELK HVKYCQYAFD LKCDSVCVNP YHYERVVSPG IDLSGLTLQS NAPSSMMVKD EYVHDFEGQP SLSTEGHSIQ TIQHPPSNRA STETYSTPAL LAPSESNATS TANFPNIPVA STSQPASILG GSHSEGLLQI ASGPQPGQQQ NGFTGQPATY HHNSTTTWTG SRTAPYTPNL PHHQNGHLQH HPPMPPHPGH YWPVHNELAF QPPISNHPAP EYWCSIAYFE MDVQVGETFK VPSSCPIVTV DGYVDPSGGD RFCLGQLSNV HRTEAIERAR LHIGKGVQLE CKGEGDVWVR CLSDHAVFVQ SYYLDREAGR APGDAVHKIY PSAYIKVFDL RQCHRQMQQQ AATAQAAAAA QAAAVAGNIP GPGSVGGIAP AISLSAAAGI GVDDLRRLCI LRMSFVKGWG PDYPRQSIKE TPCWIEIHLH RALQLLDEVL HTMPIADPQP LD

A synthetic peptide for use as a blocking control in assays to test for specificity of LGICZ1 antibody, catalog no. 70R-5201

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf190 antibody, catalog no. 70R-4302

Inhibitor of PI3K isoform p110α

Affinity purified Rabbit polyclonal RARRES3 antibody

Mouse monoclonal JEV ED3 antibody

The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.

LIPH antibody was raised in rabbit using the C terminal of LIPH as the immunogen

The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.

MATK antibody was raised in Rabbit using Human MATK as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF440 antibody, catalog no. 70R-8127

GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CKAP2 antibody was raised in rabbit using the C terminal of CKAP2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of UBLCP1 antibody, catalog no. 70R-3747

The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of Pa2g4 antibody, catalog no. 70R-9556

A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4A antibody, catalog no. 70R-2034

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-3776

A synthetic peptide for use as a blocking control in assays to test for specificity of CHST6 antibody, catalog no. 70R-5372

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDH12 antibody, catalog no. 70R-6110

A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP3 antibody, catalog no. 70R-7455

MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SESN2 antibody, catalog no. 70R-10131

A synthetic peptide for use as a blocking control in assays to test for specificity of VIM antibody, catalog no. 70R-2952

MGMT protein is a drug antibody that plays a crucial role in DNA repair and protection against alkylating agents. It is involved in the removal of alkyl groups from the O6 position of guanine, preventing the formation of DNA adducts and subsequent mutations. MGMT protein can be detected using polymerase chain reaction (PCR) or immunohistochemistry techniques. It has been shown to interact with lectins and carbonic anhydrases, suggesting its involvement in glycosylation processes and cellular metabolism. Activated MGMT protein undergoes glycan modifications, which make it more reactive and capable of binding to anti-ganglioside antibodies. In Life Sciences research, recombinant MGMT proteins are commonly used as antigens for studying immune responses and developing therapeutic strategies. Additionally, MGMT protein has been found to have natriuretic and cytotoxic effects on human hepatocytes, indicating its potential role in liver physiology and disease.

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC54 antibody, catalog no. 70R-3303

A synthetic peptide for use as a blocking control in assays to test for specificity of MSTO1 antibody, catalog no. 70R-8488

A synthetic peptide for use as a blocking control in assays to test for specificity of ORAI1 antibody, catalog no. 70R-6426

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF680 antibody, catalog no. 70R-9009

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf74 antibody, catalog no. 70R-3760

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPD antibody, catalog no. 70R-1320

A synthetic peptide for use as a blocking control in assays to test for specificity of PRKRA antibody, catalog no. 70R-5896

LSS antibody was raised in Rabbit using Human LSS as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN2 antibody, catalog no. 70R-2130

The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.

Region of VEGF C protein corresponding to amino acids MAHYNTEILK SIDNEWRKTQ CMPREVCIDV GKEFGVATNT FFKPPCVSVY RCGGCCNSEG LQCMNTSTSY LSKTLFEITV PLSQGPKPVT ISFANHTSCR CMSKLDVYRQ VHSIIRR.

Affinity purified Rabbit polyclonal DYNC1I2 antibody

BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK

MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKEGYQDYEP EA

The TP53 antibody is a glycoprotein that specifically targets the TP53 protein, also known as the tumor protein p53. This antibody is widely used in life sciences research to study the expression and function of TP53. It can be used in various applications such as Western blotting, immunohistochemistry, and immunoprecipitation. The TP53 antibody has been shown to have high specificity and sensitivity in detecting TP53 in nuclear extracts and human serum samples. This monoclonal antibody recognizes both wild-type and mutant forms of TP53, making it a valuable tool for studying the role of TP53 in cancer development and progression. With its superior performance and reliable results, the TP53 antibody is an essential reagent for researchers in the field of molecular biology and oncology.

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCC1 antibody, catalog no. 70R-1789

A synthetic peptide for use as a blocking control in assays to test for specificity of LARP1 antibody, catalog no. 70R-4916

Rabbit polyclonal CCL5 antibody (HRP)

Rabbit polyclonal SECP43 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

Goat IgG protein is a versatile immunoglobulin that has various applications in the field of Life Sciences. It can be used as a primary or secondary antibody for immunohistochemistry, Western blotting, ELISA, and other immunoassays. Goat IgG protein is highly specific and exhibits strong binding affinity to a wide range of target antigens.

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.

ELISA kit for the detection of Human HGF in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF165 antibody, catalog no. 70R-2743

Rabbit polyclonal MAZ antibody

ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Region of IL21 protein corresponding to amino acids MHKSSPQGPD RLLIRLRHLI DIVEQLKIYE NDLDPELLSA PQDVKGHCEH AAFACFQKAK LKPSNPGNNK TFIIDLVAQL RRRLPARRGG KKQKHIAKCP SCDSYEKRTP KEFLERLKWL LQKMIHQHLS.

Rabbit polyclonal CLCN6 antibody

Rabbit polyclonal SLC9A9 antibody

Affinity purified Rabbit polyclonal GMF beta antibody

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

Rabbit polyclonal VTI1A antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PIP4K2A antibody, catalog no. 70R-2708

MINA antibody was raised in Rabbit using Human MINA as the immunogen

Rabbit polyclonal SLC27A3 antibody

KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL

Mouse monoclonal Legionella pneumophila LPS antibody

Purified recombinant Human CAPSL protein

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNMB4 antibody, catalog no. 70R-5108

The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of Kcnip3 antibody, catalog no. 70R-7941

PCTK1 antibody was raised in rabbit using the N terminal of PCTK1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of NEURL antibody, catalog no. 70R-5243

A synthetic peptide for use as a blocking control in assays to test for specificity of MASTL antibody, catalog no. 70R-10147

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Rabbit polyclonal RBMS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH3 antibody, catalog no. 70R-5167

Rabbit polyclonal RIOK3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MDFIC antibody, catalog no. 70R-9021

Purified recombinant CLU protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of GPNMB antibody, catalog no. 70R-7234

A synthetic peptide for use as a blocking control in assays to test for specificity of MRE11A antibody, catalog no. 70R-9416

Mouse monoclonal PYCRL antibody

Purified Rabbit polyclonal ZNF540 antibody

KLHL13 antibody was raised in Rabbit using Human KLHL13 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of G6PC antibody, catalog no. 70R-6258

Rabbit polyclonal UQCRFS1 antibody

Purified Rat Ig fraction for use as a control or blocking reagent

A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10339

Affinity purified Rabbit polyclonal ATP synthase delta antibody

TNIK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

IL18 antibody is a monoclonal antibody that targets interleukin-18 (IL-18), a pro-inflammatory cytokine involved in immune responses. This antibody specifically binds to IL-18, inhibiting its activity and reducing inflammation. IL18 antibody has been shown to have an inhibitory effect on collagenase and glycogen synthase kinase, α subunit, which are enzymes involved in tissue degradation and inflammation. It can be used in various applications in Life Sciences research, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). IL18 antibody is also used to study the role of IL-18 in diseases such as cancer and autoimmune disorders. Whether you need a highly specific monoclonal antibody or polyclonal antibodies for your research, IL18 antibody is a valuable tool for studying the function of IL-18 and its impact on various biological processes.

5-HT6 antagonist 29 is a pharmacological compound, which is synthesized through organic chemistry techniques, typically involving multi-step reactions to yield high specificity. This compound functions as a selective antagonist for the 5-HT6 serotonin receptor, a G-protein-coupled receptor predominantly found in the central nervous system.

Rabbit polyclonal VASP antibody (Ser157)

A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6277

SC 19220 is a guanine nucleotide-binding protein (G protein) that is involved in the signal pathways of cells. It has been shown to play a role in the regulation of colony-stimulating factor, water permeability, and detrusor muscle function. SC 19220 also binds to endothelin-a receptors and regulates prostaglandin levels. This protein may be involved in bowel disease, as it has been shown to bind to polymerase chain reaction (PCR) products of DNA from bacteria that cause ulcerative colitis. SC 19220 also inhibits receptor activity for prostaglandin E2 and transcriptional regulation.