Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,693 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(400 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
CGRP antibody
CGRP antibody was raised in guinea pig using calcitonin gene-related peptide conjugated to BSA as the immunogen.Purity:Min. 95%CABP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CABP4 antibody, catalog no. 70R-9895
Purity:Min. 95%Suc-Ala-Phe-Lys-amc trifluoroacetate salt
CAS:Suc-Ala-Phe-Lys-amc trifluoroacetate salt is an analog inhibitor of protein kinases that has been shown to have potential anticancer properties. It inhibits tumor cell cycle progression and induces apoptosis in cancer cells. This medicinal compound has been extensively studied for its ability to inhibit the activity of various kinases, including those involved in cancer cell proliferation and survival. Suc-Ala-Phe-Lys-amc trifluoroacetate salt has been found to be effective against various types of human cancers, including breast, prostate, and lung cancer. It is a promising candidate for the development of novel anticancer drugs due to its potent inhibitory activity against protein kinases involved in tumor growth and survival.
Formula:C32H39N5O8Purity:Min. 95%Molecular weight:621.7 g/molRef: 3D-YCA20791
Discontinued productTYRP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TYRP1 antibody, catalog no. 70R-7374
Purity:Min. 95%C6ORF154 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf154 antibody, catalog no. 70R-4442
Alkaline Phosphatase protein (Porcine)
Alkaline Phosphatase (ALP, Orthophosphoric-Monoester Phosphohydrolase, systematic name phosphate-monoester phosphohydrolase (alkaline optimum), EC 3.1.3.1, CAS Number [9001-78-9]) is an enzyme that catalyzes the following reaction: a phosphate monoester + H2O → an alcohol + phosphate One unit catalyzes of the Alkaline Phosphatase will hydrolyze 1.0 μmol of p-nitrophenyl phosphate per minute at pH 10.35 and 37°C in the presence of 2-amino-2-methyl-1-propanol. Porcine kidney alkaline phosphatase comes in lyophilized form, lyophilized from tris chloride with magnesium chloride and zinc chloride, pH 8.0. Appearance is tan powder. Activity is ≥50U/mg, specific activity ≥50 U/mg protein. It is soluble in saline giving a clear colorless to tan solution at 1mg/mL. Store at -20°C on arrival.Purity:Min. 95%Rabbit anti Dog IgG (H + L)
Rabbit anti-dog IgG (H+L) was raised in rabbit using canine IgG whole molecule as the immunogen.Purity:Min. 95%NCRNA00114 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NCRNA00114 antibody, catalog no. 70R-3296
Purity:Min. 95%Mouse Thrombocyte antibody (FITC)
Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.
FLJ37543 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ37543 antibody, catalog no. 70R-3286
Purity:Min. 95%Ceruloplasmin protein
Ceruloplasmin protein is a vital component in the field of Life Sciences. It plays a crucial role in various biological processes. Ceruloplasmin is an antioxidant enzyme that helps protect cells from oxidative damage by neutralizing reactive oxygen species. It is also involved in the transport of copper ions throughout the body and plays a significant role in iron metabolism.Purity:>95% By Sds-Page.Fetuin A antibody
Fetuin A antibody is a highly specific monoclonal antibody that targets the protein fetuin A. This protein plays a crucial role in various biological processes, including collagen synthesis, growth factor signaling, and protein kinase activation. The antibody recognizes specific acid residues on the fetuin A protein and effectively inhibits its activity.
TMOD1 antibody
The TMOD1 antibody is a nuclear monoclonal antibody that targets endothelial growth factors. It has been shown to effectively inhibit the growth and proliferation of cells expressing c-myc, fibronectin, trastuzumab, epidermal growth factor, interleukin-6, collagen, and alpha-synuclein. This antibody is widely used in life sciences research and has proven to be a valuable tool for studying various biological processes. Its high specificity and affinity make it an ideal choice for experiments requiring precise targeting of specific proteins or molecules. With its exceptional performance and reliable results, the TMOD1 antibody is a must-have for any researcher working in the field of antibodies and life sciences.
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
Listeria antibody
The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.
Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Purity:Min. 95%SIRT7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT7 antibody, catalog no. 70R-7918
Purity:Min. 95%NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF
TC-I 2014
CAS:TC-I 2014 is a specific chemical compound known as a selective inhibitor, which is derived from microbial sources. It operates by selectively inhibiting a particular protein or signaling pathway, thereby modulating cellular processes. This compound is often used in biochemical and cellular biology research to dissect and understand complex signaling networks within cells. By selectively blocking certain pathways, researchers can identify and study the role of specific proteins in biological processes and disease mechanisms.
Formula:C23H19F6N3OPurity:Min. 95%Molecular weight:467.4 g/molRef: 3D-WYB34953
Discontinued productFMRF-Amide
CAS:A molluscan cardioexcitatory neuropeptide which has the potential to be used in cell biology, pharmacological, and protein-protein interaction studies. This product is available as an FMRF-Amide.
Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molGGT2 antibody
GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen
Purity:Min. 95%IRX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX6 antibody, catalog no. 70R-8749
Purity:Min. 95%Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.HIST2H2AA3 antibody
HIST2H2AA3 antibody was raised using the middle region of HIST2H2AA3 corresponding to a region with amino acids PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
G22P1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of G22P1 antibody, catalog no. 70R-1051
Purity:Min. 95%Ascc1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Ascc1 antibody, catalog no. 70R-9441
Purity:Min. 95%I-Msh (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)
CAS:Controlled ProductI-Msh is a peptide that was originally discovered in the central nervous system of mammals. It is a ligand for ion channels and its binding site has been mapped to the extracellular domain of the channel protein. I-Msh inhibits the activity of potassium channels, which are involved in the propagation of nerve impulses. I-Msh also binds to receptors on immune cells and regulates their activity. I-Msh has been used as a research tool to study ion channels and receptor interactions, as well as to characterize peptides and antibodies.
Formula:C79H110F3N21O21SPurity:Min. 95%Molecular weight:1,778.9 g/molRef: 3D-WGA86993
Discontinued productLOC344065 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC344065 antibody, catalog no. 70R-9046
Purity:Min. 95%Dnak protein
Substrate binding domain, C-term; 385-638 amino acids: MDVKDVLLLD VTPLSLGIET MGGVMTTLIA KNTTIPTKHS QVFSTAEDNQ SAVTIHVLQG ERKRAADNKS LGQFNLDGIN PAPRGMPQIE VTFDIDADGI LHVSAKDKNS GKEQKITIKA SSGLNEDEIQ KMVRDAEANA EADRKFEELV QTRNQGDHLL HSTRKQVEEA GDKLPADDKT AIESALTALE TALKGEDKAA IEAKMQELAQ VSQKLMEIAQ QQHAQQQTAG ADASANNAKD DDVVDAEFEE VKDKK
Purity:Min. 95%CLCA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLCA2 antibody, catalog no. 70R-8069
Purity:Min. 95%ZFP106 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP106 antibody, catalog no. 70R-7978
Purity:Min. 95%beta 2 Microglobulin antibody (HRP)
Beta-2 microglobulin antibody (HRP) was raised in rabbit using beta-2-microglobulin from human urine as the immunogen.C13ORF31 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf31 antibody, catalog no. 70R-4182
Purity:Min. 95%STC2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.
KIF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-8012
Purity:Min. 95%PTGIS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTGIS antibody, catalog no. 70R-7255
Purity:Min. 95%LGALS3BP antibody
The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.
STK11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STK11 antibody, catalog no. 70R-9641
Purity:Min. 95%SSH3 antibody
The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.
DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
ISCA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ISCA2 antibody, catalog no. 70R-2471
Purity:Min. 95%ZG16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZG16 antibody, catalog no. 70R-5441
Purity:Min. 95%ABAT antibody
ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
Goat anti Guinea Pig IgG (H + L)
Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.
Purity:Min. 95%Sonic Hedgehog Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SHH antibody, catalog no. 70R-7123
Purity:Min. 95%TMPRSS5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS5 antibody, catalog no. 70R-6998
Purity:Min. 95%ZFP36 antibody
The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.
IL28R alpha Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IL28RA antibody, catalog no. 70R-7458
Purity:Min. 95%GLUT1 antibody
GLUT1 antibody was raised in rabbit using a 12 amino acid peptide of the C-terminus of hGLUT-1 conjugated to KLH as the immunogen.Purity:Min. 95%Ubiquitin D Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBD antibody, catalog no. 70R-5744
Purity:Min. 95%SERPINI2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINI2 antibody, catalog no. 70R-9424
Purity:Min. 95%CD62E antibody
The CD62E antibody is a monoclonal antibody that has antiviral properties and is commonly used in research and medical applications. It specifically targets the CD62E protein, also known as E-selectin, which plays a crucial role in immune response and inflammation. This antibody works by binding to the CD62E protein, preventing its interaction with other molecules involved in immune cell adhesion and migration.SF3B4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-4853
Purity:Min. 95%Goat anti Rabbit IgG (20 nm Gold Colloid)
Goat anti-rabbit IgG antibody was raised in goat using rabbit IgG as the immunogen.Purity:Min. 95%NRCAM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NRCAM antibody, catalog no. 70R-1741
Purity:Min. 95%ACY-775
CAS:ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.
Formula:C17H19FN4O2Purity:Min. 95%Molecular weight:330.36 g/molRef: 3D-BA168231
Discontinued productRef: 3D-PI00789
Discontinued productCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Molecular weight:2,631.93 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Molecular weight:1,424.66 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Molecular weight:882.04 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Molecular weight:2,570 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Molecular weight:1,319.58 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Molecular weight:1,667.90 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111733
Discontinued productZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purity:Min. 95%Molecular weight:566.48 g/molRef: 3D-FG111473
Discontinued product
