Biochemicals and Reagents

The HSP antibody is a monoclonal antibody that has pharmacokinetic properties. It is formulated using crystalline cellulose and human serum, making it highly effective in targeting specific biomolecules. This antibody has been shown to be particularly effective in treating choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. The HSP antibody works by neutralizing oxidative damage and preventing toxic effects on the retina. Additionally, this monoclonal antibody has shown promising results in combination with sorafenib, an inhibitor of epidermal growth factor receptors. With its potent therapeutic properties, the HSP antibody is a valuable tool in the field of life sciences and holds great potential for future medical advancements.

FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Please enquire for more information about Protein kinase C (19-36) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about 4-Defluoro dolutegravir including the price, delivery time and more detailed product information at the technical inquiry form on this page

CHD6 antibody was raised in mouse using recombinant Human Chromodomain Helicase Dna Binding Protein 6 (Chd6)

Ro 08-2750 is a potent anti-tumor agent that inhibits the growth of cancer cells. It is structurally similar to a natural compound, largazole, which has been shown to inhibit prostate cancer cell proliferation. Ro 08-2750 may be useful for the treatment of prostate cancer and other cancers with glucocorticoid receptors. The drug also inhibits the production of proinflammatory prostaglandins and shows potent antitumor activity in both cell culture and animal models. Ro 08-2750 binds to the enzyme p-nitrophenyl phosphate (PNPP) and inhibits its activity, inhibiting DNA synthesis by blocking polymerase chain reaction (PCR). The binding affinity between Ro 08-2750 and PNPP is increased by cofactors such as ATP, making it more effective at inhibiting DNA synthesis.

Anti CRF (24-41) is an activator of the CRF receptor, which is a G protein-coupled receptor. This antibody binds to a specific region of the human CRF1 receptor and can be used as a research tool to investigate the function of the CRF receptor. Anti CRF (24-41) can also be used to inhibit cell proliferation and induce apoptosis in cancer cells. It is also used to study protein interactions with fluorescence resonance energy transfer (FRET). This antibody has been shown to inhibit voltage-gated K+ channels in neuronal cells. Anti CRF (24-41) is purified from human serum and can be used for applications such as pharmacology, peptide synthesis, or life science research.

LY2812223 is a drug that is currently in clinical development. It is a low-potency antagonist of the N-methyl-D-aspartate (NMDA) receptor and it has been shown to be effective in animal models of neurodevelopmental, psychotic, and other disorders. LY2812223 binds reversibly to the NMDA receptor and prevents the ion channel from opening. This drug has not been tested in humans, but it has been shown to have good absorption across the blood brain barrier and does not produce any neurotoxic effects. LY2812223 is being developed for the treatment of schizophrenia, bipolar disorder, major depressive disorder, autism spectrum disorders, and Alzheimer’s disease.
END>>

PF-6808472 is a peptide inhibitor of the N-methyl-D-aspartate receptor. It is a potent and selective blocker of the NMDA receptor and has been shown to have no effect on other glutamate receptors or ion channels. PF-6808472 has been shown to be an activator of NMDA receptors, which may be due to its ability to bind to the amino acid site on the receptor that is responsible for regulating activation. This agent can also act as a ligand for the receptor, binding directly with high affinity. PF-6808472 is a research tool used in studies involving protein interactions, cell biology, pharmacology and more. It has been tested in animal studies and found to be safe without any significant side effects.

Low-density lipoprotein (LDL) is a type of lipoprotein that contains a high proportion of cholesterol and triglycerides. It is called "low-density lipoprotein" because it has less protein and more fat than "high-density lipoproteins", which are the other major group of lipoproteins. LDL is the main carrier of cholesterol in the blood, and carries about 25% of all the body's cholesterol. The LDL receptor is the cellular receptor for LDL, which is located on the surface of liver cells. The binding site for LDL on its receptor is called LDL Receptor Related Protein 1 or LRP1. LRP1 binds to apolipoprotein E on LDL particles and facilitates their uptake into cells by endocytosis.

IFN-g rat is a peptide that has been used as an activator of immune cells. It binds to the interferon gamma receptor, and promotes the proliferation of T helper cells and B cells, as well as the production of cytokines. IFN-g rat is also used in research to study protein interactions and ligand-receptor binding. IFN-g rat is a recombinant human protein that has been shown to have no detectable levels of pyrogens or endotoxins.
IFN-g Rat is available in bulk quantities from Life Science Research Tools, Inc.

Rabbit polyclonal OR10AD1 antibody

TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF

Naloxone methiodide is a microdialysis probe that blocks the effects of opioids, such as morphine and codeine. It is a competitive antagonist of κ-opioid receptors and has been shown to be effective in reducing locomotor activity in rats with chronic pain. Naloxone methiodide has also been shown to block the binding of kappa-opioid receptors by naloxone. This drug has been used in vivo as a model for bowel disease, myocardial infarct, and small-molecule drug testing.

GRM6 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rocastine is a non-sedating antihistamine. It is an active ingredient in the form of a fatty acid ester that is used as an implant in the treatment of allergic disorders such as atopic dermatitis. Rocastine has been shown to inhibit adenosine receptors, which are responsible for mediating the generation of histamine from mast cells and basophils, thereby preventing allergy symptoms. Rocastine also inhibits cellular activation by suppressing the release of pro-inflammatory cytokines and chemokines, which leads to inhibition of inflammatory responses. The molecular modeling studies have shown that rocastine binds to the receptor site on histamine H1 receptors with high affinity and selectivity.

Recombinant Human RALY protein

ML 786 Dihydrochloride is a pluripotent stem cell culture supplement that contains the following: 50% fetal bovine serum, 25% Dulbecco's Modified Eagle Medium, 10% horse serum, 10% human serum, and 5% dimethyl sulfoxide. It is used to support the growth of pluripotent cells.