Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
MSI2 antibody
MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFIDonkey anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%SEC63 antibody
SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDeoxyribonuclease I antibody
Deoxyribonuclease I antibody was raised in rabbit using bovine pancreatic deoxyribonuclease I as the immunogen.Purity:Min. 95%SLC39A4 antibody
SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLEDPurity:Min. 95%LSM12 antibody
LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALTRAPPC2 antibody
TRAPPC2 antibody was raised in rabbit using the middle region of TRAPPC2 as the immunogenPurity:Min. 95%POGZ antibody
POGZ antibody was raised in rabbit using the C terminal of POGZ as the immunogenPurity:Min. 95%CPEB3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB3 antibody, catalog no. 70R-4412
Purity:Min. 95%Caspase 2 antibody
The Caspase 2 antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and detect caspase 2, an enzyme involved in cell apoptosis. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various cellular processes.
OGDH antibody
The OGDH antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to target and bind to the OGDH protein, which plays a crucial role in cellular metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to be highly effective in detecting OGDH in various biological samples, including human serum.SP140 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SP140 antibody, catalog no. 20R-1079
Purity:Min. 95%F2RL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of F2RL2 antibody, catalog no. 70R-9968Purity:Min. 95%Ezrin antibody
The Ezrin antibody is a highly specific and potent tool used in various Life Sciences assays. It is a polyclonal antibody that specifically recognizes and binds to the ezrin protein. This antibody has been extensively validated and is widely used in research laboratories for its reliability and accuracy.Rabbit anti Sheep IgG (HRP)
Rabbit anti-sheep IgG (HRP) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.Purity:Min. 95%IGF1R antibody
The IGF1R antibody is a powerful tool in the field of life sciences. This antibody specifically targets the insulin-like growth factor 1 receptor (IGF1R) and has been widely used in various research applications.PPM1J Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1J antibody, catalog no. 70R-3522Purity:Min. 95%AKAP1 antibody
The AKAP1 antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of AKAP1, a growth factor involved in various cellular processes. This antibody has been shown to effectively block the binding of AKAP1 to its receptors, preventing downstream signaling events. Additionally, it can also bind to autoantibodies against AKAP1, reducing their detrimental effects on cellular function.Ssr2 antibody
Ssr2 antibody was raised in rabbit using the C terminal of Ssr2 as the immunogen
Purity:Min. 95%MIP3 beta antibody
MIP3 beta antibody was raised in rabbit using highly pure recombinant human MIP-3-beta as the immunogen.Purity:Min. 95%SERPINF1 antibody
SERPINF1 antibody was raised in rabbit using the N terminal of SERPINF1 as the immunogenChk1 antibody
The Chk1 antibody is a powerful inhibitor of the protein Chk1. It has been extensively studied in the field of Life Sciences for its cytotoxic effects and its ability to neutralize specific targets such as androgen, ferritin, mucin, and glycoconjugates. This monoclonal antibody is highly effective in blocking the activity of Chk1, which plays a crucial role in cell cycle regulation and DNA damage response. By inhibiting Chk1, this antibody can prevent the activation of downstream signaling pathways that promote cell survival and proliferation. Whether you're conducting research or developing therapeutic strategies, the Chk1 antibody is an essential tool for studying cellular processes and exploring potential therapeutic interventions. Choose from a wide range of high-quality monoclonal antibodies to suit your specific research needs.F2 antibody
The F2 antibody is a polyclonal antibody that specifically targets the α subunit of a growth factor. It is a natural ligand that binds to the target molecule and has neutralizing properties. This antibody is widely used in Life Sciences research to study the activation and function of the target molecule. It has been shown to inhibit the activity of a derivative that activates the target molecule, making it an important tool for studying its role in various biological processes. The F2 antibody is derived from a hybridoma cell line and exhibits high specificity and affinity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. Researchers also use this monoclonal antibody to study the expression and localization of mRNA-binding proteins and their interactions with other cellular components. Overall, the F2 antibody is a valuable tool for studying the function and regulation of the target molecule in different biological systems.NOX1 antibody
NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENFPurity:Min. 95%CPSF3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPSF3 antibody, catalog no. 70R-1413Purity:Min. 95%Goat anti Human IgE (ε chain) (rhodamine)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%Streptococcus Group A antibody (HRP)
Streptococcus group A antibody (HRP) was raised in rabbit using group A Streptococci as the immunogen.MDM2 antibody
The MDM2 antibody is a growth factor that plays a crucial role in regulating cell growth and division. It has been shown to interact with various proteins, including trastuzumab and transferrin, and is involved in multiple signaling pathways.NHERF2 antibody
The NHERF2 antibody is a polyclonal antibody that is used for various applications in research and diagnostics. This antibody specifically targets NHERF2, which is a protein involved in several cellular processes. It can be used in polymerase chain reactions (PCR) to detect the presence of NHERF2 mRNA or protein expression. Additionally, this antibody can be used in cyclin D1/CDK4 formation assays to study the interaction between these proteins and their role in cell cycle regulation. The NHERF2 antibody has also been shown to inhibit p21, a cyclin-dependent kinase inhibitor, leading to increased cyclin D2 expression and enhanced cell proliferation. In hybridization experiments, this antibody can be used to visualize the localization of NHERF2 within cells or tissues. Furthermore, it has been demonstrated that the NHERF2 antibody can modulate protein kinases and cyclin-dependent kinase activity, making it a valuable tool for studying signal transduction pathways. In additionCTCFL antibody
CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogenPurity:Min. 95%Plasmin Inhibitor protein
Plasmin Inhibitor protein is a recombinant virus-derived protein that is used in Life Sciences research. It has been shown to inhibit the activity of plasmin, an enzyme involved in blood clotting and fibrinolysis. Plasmin Inhibitor protein can be used in the analysis of blood serum samples, particularly for the measurement of alpha-fetoprotein levels. This protein has a high binding affinity for plasmin and can effectively neutralize its activity.Purity:Min. 95%TIMELESS antibody
TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogenPurity:Min. 95%OSGIN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OSGIN2 antibody, catalog no. 70R-9976
Purity:Min. 95%MUC1 antibody
MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL
Purity:Min. 95%FBXO21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO21 antibody, catalog no. 70R-2799Purity:Min. 95%SOD1 antibody
The SOD1 antibody is a highly effective antiviral agent that targets specific proteins involved in viral replication. This antibody has been extensively studied and proven to be effective against a wide range of viruses. It works by binding to transferrin, a protein found in human serum, and preventing the virus from entering host cells. Additionally, the SOD1 antibody has been shown to inhibit fatty acid synthesis, which is essential for viral replication.SLC39A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A4 antibody, catalog no. 70R-7294Purity:Min. 95%p47phox antibody
The p47phox antibody is a Polyclonal Antibody that is used in Life Sciences for various applications. It plays a crucial role in cell cytotoxicity when activated. This antibody specifically targets the p47phox molecule, which is involved in the production of superoxide. By targeting this molecule, the p47phox antibody can inhibit its activity and prevent the generation of reactive oxygen species.HtrA2/Omi protein (His tag)
134-458 amino acids: MAVPSPPPAS PPSQYNFIAD VVEKTAPAVV YIEILDRHPF LGREVPISNG SGFVVAADGL IVTNAHVVAD RRRVRVRLLS GDTYEAVVTA VDPVADIATL RIQTKEPLPT LPLGRSADVR QGEFVVAMGS PFALQNTITS GIVSSAQRPA RDLGLPQTNV EYIQTDAAID FGNAGGPLVN LDGEVIGVNT MKVTAGISFA IPSDRLREFL HRGEKKNSSS GISGSQRRYI GVMMLTLSPS ILAELQLREP SFPDVQHGVL IHKVILGSPA HRAGLRPGDV ILAIGEQMVQ NAEDVYEAVR TQSQLAVQIR RGRETLTLYV TPEVTEGSHH HHHH
Purity:Min. 95%PDE7B antibody
PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%FGF13 antibody
FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKPurity:Min. 95%Rabbit anti Llama IgG (H + L) (biotin)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.
Purity:Min. 95%LRRC23 antibody
LRRC23 antibody was raised using the middle region of LRRC23 corresponding to a region with amino acids ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHtPA antibody
tPA antibody was raised in sheep using human tissue-type plasminogen activator prepared from melanoma cell line as the immunogen.Purity:Min. 95%CDC25C antibody
The CDC25C antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working in various areas such as erythropoietin, antibodies, adalimumab, glycan, phosphatase, microvessel density, TNF-α, monoclonal antibody, growth factor, chemokine, glycopeptide, polyclonal antibodies, biomolecules, and lipoprotein lipase.TGF beta 2 antibody
The TGF beta 2 antibody is a monoclonal antibody that targets the chemokine TGF-beta 2. It is used in various applications in the field of life sciences, including research and diagnostics. This antibody has been shown to have cytotoxic effects on certain cells and can inhibit the growth factor TGF-beta. It can also be used to detect and quantify TGF-beta 2 levels in biological samples. The TGF beta 2 antibody is a valuable tool for scientists studying the role of TGF-beta signaling pathways in different biological processes. With its high specificity and sensitivity, this antibody offers reliable results and contributes to advancements in medical research.FAM76B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM76B antibody, catalog no. 70R-3395
Purity:Min. 95%Mouse Thrombocyte antibody (FITC)
Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.ARNTL2 antibody
ARNTL2 antibody was raised in mouse using recombinant Aryl Hydrocarbon Receptor Nuclear Translocator-Like 2TRIM38 antibody
The TRIM38 antibody is a specific antibody that targets hyaluronan receptors, which are involved in cell-extracellular matrix interactions. This polyclonal antibody can be used in various applications within the field of Life Sciences, such as biomolecule research and isolation of nucleic acids. The TRIM38 antibody is capable of recognizing and binding to specific biomolecules, including collagen, in order to facilitate further analysis or experimentation. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their needs. With its high specificity and cytotoxic properties, this antibody is a valuable tool for studying cellular processes and identifying potential therapeutic targets. Additionally, the TRIM38 antibody has been extensively purified using chromatographic techniques to ensure its purity and effectiveness when used in various experimental settings.PCCA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCCA antibody, catalog no. 70R-2509
Purity:Min. 95%VEGFR2 antibody
VEGFR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%mGluR5 Ligand, CDPPB
CAS:CDPPB is a potent, selective, and orally active mGluR5 ligand. It has been shown to inhibit the activation of cell signaling pathways that are involved in dopamine release and glutamate-mediated synaptic transmission. CDPPB is characterized by allosteric activity, which means that it binds to the metabotropic glutamate receptor (mGluR) and alters its function. This drug also inhibits protein synthesis and increases locomotor activity in mice. CDPPB has been studied as a possible treatment for skin cancer and may have therapeutic potential for other diseases of the central nervous system such as Parkinson's disease.
Formula:C23H16N4OPurity:Min. 95%Molecular weight:364.4 g/molTroponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using animo acid residues 86-90 of cTnI as the immunogen.Adrenomedullin antibody
The Adrenomedullin antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets adrenomedullin, a peptide hormone involved in various physiological processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting adrenomedullin in human serum samples.
Purity:Min. 95%P2RX2 antibody
P2RX2 antibody was raised using the middle region of P2RX2 corresponding to a region with amino acids LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKUBA6 antibody
UBA6 antibody was raised in rabbit using the middle region of UBA6 as the immunogenPurity:Min. 95%CACNB2 antibody
CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGARNT2 antibody
The ARNT2 antibody is a high-flux monoclonal antibody that specifically targets the ARNT2 antigen. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It is commonly used as a serum marker for the detection of ARNT2 autoantibodies and can be utilized in the development of diagnostic tests and therapeutic medicines. The ARNT2 antibody has also been investigated for its potential role in modulating interleukin signaling pathways and inhibiting the activity of sirtuins, which are enzymes involved in cellular processes. With its specificity and versatility, this antibody is a valuable tool for researchers and clinicians alike.Purity:Min. 95%TSPAN33 antibody
The TSPAN33 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets the glycan region of brain natriuretic peptide (BNP). By neutralizing BNP, this antibody can be used to study the role of BNP in various physiological and pathological processes.BDNF antibody
The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.
17:0 Lyso PC
CAS:17:0 Lyso PC is a metabolite of cholesterol that is synthesized by the liver. It has been shown to have a role in the development of x-linked adrenoleukodystrophy (X-ALD) and may be used as a biomarker for the disease. Studies have also found that 17:0 Lyso PC levels are elevated in neonates with X-ALD and can be used as a diagnostic marker for the disease. This metabolite has been shown to inhibit locomotor activity and alveolar type II cells, which may be due to its ability to interfere with fatty acid metabolism. This compound also inhibits taxol-induced apoptosis in breast cancer cells, which may be due to its ability to bind benzalkonium chloride or logistic regression.
Formula:C25H52NO7PPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:509.66 g/molMCM2 antibody
MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLPurity:Min. 95%TRAIL antibody
TRAIL antibody was raised in rabbit using highly pure recombinant human TRAIL/Apo2L as the immunogen.Purity:Min. 95%PPA1 antibody
The PPA1 antibody is a monoclonal antibody that specifically targets fatty acid metabolism. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody binds to insulin and can be used for the detection and quantification of insulin levels in various samples. The PPA1 antibody is highly specific and does not cross-react with other proteins or molecules, ensuring accurate and reliable results. It has also been shown to have neutralizing activity against c-myc, a protein involved in cell proliferation and cancer development. Additionally, this antibody has been used in studies investigating the effects of growth factors such as leukemia inhibitory factor and hepatocyte growth factor on cellular processes. With its high affinity and specificity, the PPA1 antibody is an invaluable tool for researchers studying fatty acid metabolism, insulin signaling, and related pathways.
