Biochemicals and Reagents

<p>RG7834 is an investigational biochemical compound, classified as a small molecule inhibitor. It is derived from synthetic sources utilizing advanced chemical synthesis techniques to ensure high specificity and potency. The mode of action of RG7834 involves selective targeting and inhibition of specific molecular pathways, which are critical in various cellular mechanisms. This inhibitory activity enables researchers to closely examine the impacts on genetic transcription and cellular responses.</p>

<p>SU10944 is a drug that belongs to the class of slow-release drugs. It is used as an antiangiogenic therapy for prostate cancer and other diseases. SU10944 inhibits angiogenesis by binding to the stem cell factor receptor, which prevents the growth of new blood vessels and reduces inflammation. SU10944 also blocks prostaglandin synthesis and has chemotactic activity on monocytes and macrophages, which can be used in combination with other treatments to reduce or prevent metastasis. The drug also has biofunctional properties, such as promoting the release of epidermal growth factor (EGF) and angiogenic process.</p>

<p>DDP-38003 dihydrochloride is a research tool for the study of ion channels, ligand binding and protein interactions. DDP-38003 dihydrochloride has been shown to be an inhibitor of voltage-gated potassium channels with IC50 values in the micromolar range. This compound also binds to the beta2-adrenergic receptor and acts as an agonist.</p>

<p>Dgat2 inhibitor 122 is a research tool that can be used to inhibit the activation of the Dgat2 receptor. This inhibitor binds to the ligand binding site of Dgat2, preventing the activation of Dgat2 by its ligand. The structure of this inhibitor was solved using X-ray crystallography and it is a potent competitive antagonist with high purity. It has been shown to inhibit ion channels, which may be due to its ability to block protein interactions at the membrane level.</p>

Please enquire for more information about N-[2-[1,2-Dihydro-1'-[cis-4-(1-methylethyl)cyclohexyl]-3-oxospiro[isoquinoline-4(3H),4'-piperidin]-2-yl]ethyl]-sulfamide including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Inhibitor of multiple receptor tyrosine kinases</p>

<p>Neuropeptide S (Mouse) is a peptide with CAS No. 412938-74-0. It is an activator of ion channels and has been shown to inhibit the production of inflammatory cytokines. Neuropeptide S (Mouse) is a research tool that can be used in antibody detection, protein interactions, receptor binding, ligand activity, and pharmacology studies.</p>

<p>Lj-1-60 is a specific treatment for cancer. It activates the matrix metalloproteinases, which are enzymes that degrade extracellular matrix proteins in cancerous tissues. Lj-1-60 also has an inhibitory effect on growth factor activity, which may contribute to the reduction of tumor size and weight. Lj-1-60 inhibits DNA replication and induces apoptosis in human colon carcinoma cells by activating caspase 3/7. This drug also has an inhibitory effect on angiogenesis, as shown by staining with anti-CD34 antibodies and quantification of microvessel density in tissues from xenograft tumors.</p>

<p>UNC 1025 is a research tool for the study of ion channels and receptor interactions. It is a peptide ligand that binds to the nicotinic acetylcholine receptor (nAChR) at the extracellular domain and blocks the flow of ions through the channel. UNC 1025 has been shown to activate various ion channels, including nicotinic acetylcholine receptors and voltage-gated potassium channels. UNC 1025 also inhibits enzyme activity by binding to an inhibitor site on Ligand-gated ion channels. UNC 1025 is a high purity product with CAS No. 1350549-36-8.</p>

<p>Epelsiban is an oxytocin receptor antagonist, which is a chemically synthesized compound. It functions by selectively blocking the oxytocin receptor, thereby inhibiting the effects mediated by oxytocin, a naturally occurring hormone involved in uterine contractions. This mode of action is particularly significant in the context of managing preterm labor.</p>

<p>5-Amino-N-tert-butyl-4-(3-methoxyphenyl)-2-(methylthio)-6-thieno[2,3-d]pyrimidinecarboxamide (MTBPC) is a hydrogen bond activator. It activates the human chorionic gonadotropin (hCG) receptor and other hormone receptors. MTBPC has been shown to have allosteric binding properties and can modulate the activity of certain enzymes. MTBPC has been shown to have an activating effect on recombinant proteins and is used for biochemical analysis as a model molecule. This molecule can also be used for modelling purposes as well as in the study of extracellular activation mechanisms. MTBPC has been shown to have pleiotropic effects on biochemical processes that are associated with hormone receptors and their activity.</p>

<p>Lanraplenib succinate is an antibody that can bind to proteins in a cell, thereby inhibiting their function. Lanraplenib succinate is a research tool for the study of cell biology and pharmacology. It is also used as a ligand to activate ion channels and receptors in cells. The antibody has been shown to inhibit the activity of some protein interactions, such as those involved in the regulation of life sciences, or those that lead to protein-protein interactions.</p>

N-((1R)-1-[3-[[4-Chloro-3-(cyclopropylsulfonylamino)-1-(2,2-difluoroethyl)indazol-7-yl]-6-(3-methyl-3-methylsulfonylbut-1 -ynyl)pyridin-2-yl]phenyl]-2-(3,5-difluorophenyl)ethyl)-2-[(2R,4S)-9-(difluoromethyl)-5,5 -difluoro-7,8 -diazatricyclo[4.3.0.02, 4]nona -1 (6),8 -diazanonadecane])

1-Myristoyl-2-stearoyl-sn-glycero-3-phosphocholine is a surfactant that is used in wastewater treatment. It is a chemical compound that is made from soybean trypsin and has the chemical structure of a phospholipid. This surfactant can be used for process control and monitoring, as it can be detected by its ability to induce changes in lipid dynamics and ionic properties. 1-Myristoyl-2-stearoyl-sn-glycero-3-phosphocholine also exhibits diagnostic properties, which include its ability to predict the fatty acid composition of fetal bovine serum and diagnose an individual's cholesterol levels. The thermal expansion of this surfactant has been shown to be sensitive to changes in temperature.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PYY antibody, catalog no. 70R-6244</p>

<p>Affinity purified Rabbit polyclonal MDH2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5605</p>

<p>Pneumolysin protein is a highly functional and versatile protein that plays a crucial role in various biological processes. It is known for its hemolytic activity, which refers to its ability to cause the destruction of red blood cells. However, this protein can also have neutralizing effects when appropriate antibodies are present.</p>

<p>DHDDS antibody was raised in Rabbit using Human DHDDS as the immunogen</p>

<p>C11ORF74 antibody was raised using the middle region of C11Orf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD</p>

<p>OPN3 antibody was raised in rabbit using the C terminal of OPN3 as the immunogen</p>

<p>Rat monoclonal CD1d antibody (biotin)</p>

<p>Goat anti-human kappa chain (Fab'2) (HRP) was raised in goat using human kappa chain as the immunogen.</p>

<p>42-209 amino acids: MGSSHHHHHH SSGLVPRGSH RSMGICKWFN VRMGFGFLSM TARAGVALDP PVDVFVHQSK LHMEGFRSLK EGEAVEFTFK KSAKGLESIR VTGPGGVFCI GSERRPKGKS MQKRRSKGDR CYNCGGLDHH AKECKLPPQP KKCHFCQSIS HMVASCPLKA QQGPSAQGKP TYFREEEEEI HSPTLLPEAQ N</p>

<p>Rabbit polyclonal CEBP alpha antibody (Thr226)</p>

<p>GABRG2 antibody was raised in rabbit using the N terminal of GABRG2 as the immunogen</p>

<p>Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.</p>

Rabbit polyclonal MPZ antibody

<p>Rabbit polyclonal PHKG1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2W1 antibody, catalog no. 70R-9893</p>

<p>The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.</p>

<p>BI-2852 is a drug binding inhibitor that is selective for the protein kinases of the Src family and inhibits the phosphorylation of tyrosine residues on these proteins. BI-2852 binds to and blocks the ATP-binding site on these enzymes, preventing their activation. This compound was shown to inhibit cancer cell growth in vitro and in vivo, by inducing cell cycle arrest and apoptosis. BI-2852 has been shown to be an allosteric inhibitor, activating the enzyme at lower concentrations than those required for the classical inhibitors. It also inhibits protein synthesis by binding to and inhibiting ribosomes in bacteria.</p>

<p>Rabbit polyclonal RAB3C antibody</p>

<p>The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Mouse monoclonal CRYZL1 antibody</p>

<p>PPM1J antibody was raised using a synthetic peptide corresponding to a region with amino acids YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS</p>

<p>Affinity purified Chicken polyclonal Beta Tubulin 3 antibody</p>

<p>ZNF791 antibody was raised in rabbit using the N terminal of ZNF791 as the immunogen</p>

<p>PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZADH2 antibody, catalog no. 70R-4445</p>

<p>GMCSF antibody was raised in Rat using recombinant human GM-CSF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4826</p>

AMBMP Hydrochloride is a synthetic compound, specifically designed for research purposes in the field of neuroscience. This compound is derived from a series of carefully crafted chemical reactions, typically originating from a laboratory setting specializing in organic synthesis. Its primary mode of action is as a selective ligand targeting specific receptors within the central nervous system, allowing researchers to investigate receptor function and signaling pathways with precision.

<p>Rabbit polyclonal CPI17 alpha antibody</p>

<p>Zoledronic acid monohydrate EP Impurity B is a chemical impurity often encountered in the synthesis and quality control of zoledronic acid. This impurity arises from synthetic pathways involved in the production of bisphosphonates, a class of compounds used for bone-related conditions. As an impurity, it does not have direct therapeutic action but plays a significant role in the characterization and purity assessment of pharmaceutical formulations.</p>

<p>CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen</p>

<p>FLJ37543 antibody was raised using the middle region of FLJ37543 corresponding to a region with amino acids PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS</p>

<p>The Aurora Kinase antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits Aurora Kinase, an enzyme involved in cell division and proliferation. This antibody has been shown to have inhibitory effects on leukemia inhibitory factor (LIF) signaling, which plays a crucial role in stem cell self-renewal and differentiation. Additionally, the Aurora Kinase antibody can be used as an electrode for detecting antiphospholipid antibodies, which are associated with autoimmune disorders and anticoagulant activity. Furthermore, this antibody has potential antiviral properties and can be used in the development of inhibitors or therapeutic antibodies against viral infections. Its specificity towards tyrosine phosphorylation makes it a valuable tool for studying signal transduction pathways involving dopamine, interferon, and other important cellular processes.</p>

<p>Purified Polyclonal ABL1/2 antibody</p>

<p>Rabbit polyclonal UPK2 antibody</p>

<p>Purified Polyclonal AHA1 antibody</p>

<p>AP homeodomain antibody was raised in rabbit using Antennapedia homeodomain sequence RQIKIWFQNRRMKWKK as the immunogen.</p>

IL4 antibody was raised in rabbit using highly pure recombinant human IL-4 as the immunogen.

<p>The GATA1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and inhibitors, specifically designed to target and neutralize GATA1 protein. This monoclonal antibody has been extensively studied and proven to be highly effective in various applications.</p>

<p>TIE2 antibody was raised in rabbit using a 20 amino acid peptide from human TIE2 as the immunogen.</p>

The PFN1 antibody is a specific monoclonal antibody used in Life Sciences. It targets and binds to the protein PFN1, which is involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the field of cancer research. It has shown promising results in inhibiting the growth and proliferation of cancer cells by blocking the activity of PFN1.

<p>Thyroid Peroxidase Human Recombinant protein containing 834 amino acids.</p>

<p>RPS9 antibody was raised in rabbit using the C terminal of RPS9 as the immunogen</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>LRRC23 antibody was raised using the middle region of LRRC23 corresponding to a region with amino acids ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH</p>

tPA antibody was raised in sheep using human tissue-type plasminogen activator prepared from melanoma cell line as the immunogen.

<p>Purified Polyclonal MT ND2 antibody</p>

<p>The CDC25C antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working in various areas such as erythropoietin, antibodies, adalimumab, glycan, phosphatase, microvessel density, TNF-α, monoclonal antibody, growth factor, chemokine, glycopeptide, polyclonal antibodies, biomolecules, and lipoprotein lipase.</p>

<p>ACCS antibody was raised in Rabbit using Human ACCS as the immunogen</p>

<p>Recombinant human IL-10</p>

<p>The TGF beta 2 antibody is a monoclonal antibody that targets the chemokine TGF-beta 2. It is used in various applications in the field of life sciences, including research and diagnostics. This antibody has been shown to have cytotoxic effects on certain cells and can inhibit the growth factor TGF-beta. It can also be used to detect and quantify TGF-beta 2 levels in biological samples. The TGF beta 2 antibody is a valuable tool for scientists studying the role of TGF-beta signaling pathways in different biological processes. With its high specificity and sensitivity, this antibody offers reliable results and contributes to advancements in medical research.</p>

<p>Recombinant Human GTF3C6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM76B antibody, catalog no. 70R-3395</p>

<p>Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.</p>

<p>Rabbit polyclonal PCOLCE antibody</p>

ARNTL2 antibody was raised in mouse using recombinant Aryl Hydrocarbon Receptor Nuclear Translocator-Like 2

<p>The TRIM38 antibody is a specific antibody that targets hyaluronan receptors, which are involved in cell-extracellular matrix interactions. This polyclonal antibody can be used in various applications within the field of Life Sciences, such as biomolecule research and isolation of nucleic acids. The TRIM38 antibody is capable of recognizing and binding to specific biomolecules, including collagen, in order to facilitate further analysis or experimentation. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their needs. With its high specificity and cytotoxic properties, this antibody is a valuable tool for studying cellular processes and identifying potential therapeutic targets. Additionally, the TRIM38 antibody has been extensively purified using chromatographic techniques to ensure its purity and effectiveness when used in various experimental settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCCA antibody, catalog no. 70R-2509</p>

<p>VEGFR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Armenian Hamster monoclonal CD48 antibody (FITC)</p>

<p>CDPPB is a potent, selective, and orally active mGluR5 ligand. It has been shown to inhibit the activation of cell signaling pathways that are involved in dopamine release and glutamate-mediated synaptic transmission. CDPPB is characterized by allosteric activity, which means that it binds to the metabotropic glutamate receptor (mGluR) and alters its function. This drug also inhibits protein synthesis and increases locomotor activity in mice. CDPPB has been studied as a possible treatment for skin cancer and may have therapeutic potential for other diseases of the central nervous system such as Parkinson's disease.</p>

<p>Troponin I antibody (cardiac) was raised in mouse using animo acid residues 86-90 of cTnI as the immunogen.</p>

<p>The Adrenomedullin antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets adrenomedullin, a peptide hormone involved in various physiological processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting adrenomedullin in human serum samples.</p>

<p>P2RX2 antibody was raised using the middle region of P2RX2 corresponding to a region with amino acids LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK</p>

<p>Rabbit polyclonal NDKA antibody (biotin)</p>

<p>UBA6 antibody was raised in rabbit using the middle region of UBA6 as the immunogen</p>

<p>CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQG</p>

<p>The ARNT2 antibody is a high-flux monoclonal antibody that specifically targets the ARNT2 antigen. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It is commonly used as a serum marker for the detection of ARNT2 autoantibodies and can be utilized in the development of diagnostic tests and therapeutic medicines. The ARNT2 antibody has also been investigated for its potential role in modulating interleukin signaling pathways and inhibiting the activity of sirtuins, which are enzymes involved in cellular processes. With its specificity and versatility, this antibody is a valuable tool for researchers and clinicians alike.</p>

<p>The TSPAN33 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets the glycan region of brain natriuretic peptide (BNP). By neutralizing BNP, this antibody can be used to study the role of BNP in various physiological and pathological processes.</p>

<p>The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.</p>

<p>17:0 Lyso PC is a metabolite of cholesterol that is synthesized by the liver. It has been shown to have a role in the development of x-linked adrenoleukodystrophy (X-ALD) and may be used as a biomarker for the disease. Studies have also found that 17:0 Lyso PC levels are elevated in neonates with X-ALD and can be used as a diagnostic marker for the disease. This metabolite has been shown to inhibit locomotor activity and alveolar type II cells, which may be due to its ability to interfere with fatty acid metabolism. This compound also inhibits taxol-induced apoptosis in breast cancer cells, which may be due to its ability to bind benzalkonium chloride or logistic regression.</p>

<p>RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY</p>

<p>Purified recombinant EXOSC1 protein (His tag)</p>

<p>NEGR1 antibody was raised in rabbit using the N terminal of NEGR1 as the immunogen</p>

<p>Rabbit polyclonal RAB31 antibody</p>

<p>Rabbit polyclonal OR8G1 antibody</p>

<p>Affinity purified Rabbit polyclonal Cyclin T2 antibody</p>

<p>FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM</p>

Phenytoin (USP grade powder) chemical reference substance

<p>The SAMHD1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SAMHD1, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and analyzing SAMHD1 expression in different tissues and cell types.</p>

<p>The Cathepsin G antibody is a highly effective and versatile basic protein that plays a crucial role in the immune system. This antibody specifically targets and neutralizes the activity of Cathepsin G, an enzyme involved in various physiological processes. By inhibiting Cathepsin G, this antibody helps regulate immune responses and maintain overall health.</p>

<p>PPP2R5D antibody was raised using the middle region of PPP2R5D corresponding to a region with amino acids ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA</p>

<p>The TIMP2 antibody is a monoclonal antibody that specifically targets and binds to TIMP2 (Tissue Inhibitor of Metalloproteinase 2). This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Rabbit polyclonal STAT3 antibody (Ser727)</p>

<p>Mouse monoclonal POLR2J2 antibody</p>